KEGG   Equus caballus (horse): 100061676Help
Entry
100061676         CDS       T01058                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100061676 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100061676 (PLCE1)
   04015 Rap1 signaling pathway
    100061676 (PLCE1)
   04020 Calcium signaling pathway
    100061676 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100061676 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100061676 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100061676 (PLCE1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100061676 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2299 aa AA seqDB search
MTSEEMAASVLIPVTQRKVISVQGAVDESSEKVSDISVPKVHTIRQSGPTSHAISQLNTL
KEESSGSNLPKIFSIAREKIMSDENSNEKCWEKTMPDSVKNLNINCNNILKNLPQSQFYE
TCDSVTEEGLCMETGIPSSLERKVFPGIQLEIDGPPKDVSPLGNQSAIMDTSRARSDSNM
AVFHFHYEVDRGMSDTFCTLSDNLILDDCGNCVPLPGVGGEQKKNYMAYTCKLMELAKNC
DNKNGQLQCDHCDTLNDKYLCFEGSCQKANVVCSSDSFCKEDFTDSPPAKTFLSHLEDFP
DNCEDVEEDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLGAWSYI
DQKRNGLLLPCGRVTERLSTVVTGQDGSRCLSEAQWYPIYTAVRRGEGTEDTIGSLLHVF
TELPASERAHERISIGLCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSGL
LNTFGGSTGRMMMKERQPGTSMANSSALPSSSAGISKELIDLQPLIQFPEEVASILMEQE
QNIYRRVLPVDYLCFLTRDLGTPECQRSLPCLKASISASILTSQNGEHNALEDLLMRFNE
VSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFM
DQSDLETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEALDGASGL
MKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQIIRSCSRSLET
EEEDSPSEGNSSRKNSLKDKARWQFIIGDLLDSENDIFEQPKEWDPHGSEEPQKAFDHGT
ELIPWYVLSIQADVHQFLLQGATVIHYDQDMHLSARCFLRLQPDNSTLTWMKPTTASPAS
AKAKLGVLSNTSEPGKFPLLGSAGLSSLVEGVLDLFSAKAVYMGHPSIDIHTVCVQNKLG
SMLLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTKAVRKMRKFPDQRQQWL
RKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGTSAKSAEKPNVQRNNTLGIST
TKKKKKILMRGESGEATDDEMATRKVKVHKECRSRSGSDPQDANEPEESEANAITSPPNP
LPSRRAHSLTTAGSPNLASGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKGF
QSFMVSDSNMSFIEFVELFKSFSVRSRKDLKDLFDIYAVPCNRAGSESAPLYTNLTIDEN
TSGLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFG
VGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLMSFEGFARFLMDKDNFASK
NDESQENSRELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDG
DDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKT
VFGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQ
AQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEI
PKRIKKADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTL
NASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSYEGMRQAWEESSSPLNPTT
SLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLM
FWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDL
DNMEPAVYSLSIVSGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQ
FLFRVHFEDLVFLRFAVVENNSSAVTAQRVIPLKALKRGYRHLQLRNLHNEILEISSLFI
NSRRMEENSSSNTVPSSLMFNTEERKCLQTHRVTVHGVPGPEPFTVFSINGGTKAKQLLQ
QILATEQDTKPIATDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGY
VGRIVLKTQQENLEEKNIVPEDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQD
VIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKSSTPKSSQRVLLDQECVFQAQS
KWKGAGKFILKLKEQVQASREDKRKGISFASEFKKLTKSTKQPRGLTSPSQVLASESVQN
KEEKPVGSLSSSDTTDYRQ
NT seq 6900 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatggcagcttctgttctcatacctgtgactcagagaaaagtgata
tctgttcaaggggctgttgatgaaagtagtgaaaaggtctcagacatcagtgttccaaaa
gtgcatactatcagacagagtgggccaacttctcatgccatctcacaactgaacacactt
aaagaagaatcttctggaagcaacttgcccaagattttctccatagcaagggagaaaata
atgagtgacgagaacagtaatgaaaagtgctgggagaaaaccatgccagattctgtgaaa
aaccttaacattaactgtaacaacatattgaaaaaccttcctcagagccagttttatgaa
acatgtgattctgtcacagaggaaggcctgtgtatggaaactggaatcccttcttcactg
gaaagaaaggtgttccctggaattcaactggaaatagacggacctcccaaggacgttagt
cccttaggaaatcaatcagcgatcatggataccagcagggcacgctctgacagcaacatg
gcggtatttcactttcactatgaagttgacagaggaatgtcagacactttctgtaccctg
tcagataacttgattttggatgattgtggaaactgtgtaccactgcctggtgttggtgga
gagcaaaagaaaaattacatggcgtatacttgtaaactgatggaattggcaaaaaactgt
gataataagaatggacagctgcagtgtgatcattgtgacaccttgaatgacaaatacttg
tgctttgaaggttcttgccagaaggccaatgtggtatgttcaagcgacagcttttgcaag
gaggattttactgacagtcctcctgcgaagacctttctgagccatttggaagacttccct
gataattgtgaagatgtagaagaagattttttcaaaagcaaaaaggagcgatccactttg
ttagtgaggagattttgtaaaaatgacagggaagttaagaaatctgtgtacactgggaca
agggcaattgtgagaactctgccttctggtcacattgggctgggagcttggagttacatt
gatcagaagagaaatggtctcttgttgccctgtgggagagtaacggaacggctgtcaaca
gtggtgactgggcaagatgggagccggtgtctgtcagaagcccagtggtatccgatctac
actgcagtgagaaggggagaaggaacagaagatacaattggatctcttctccatgtcttc
acagagctcccagcctctgagagagcccatgaaaggattagcattggtctgtgcttaaag
caatgtgtccgagacaccgtgtgtgagtatcgtgccaccctccaaaggacttccatatcg
cagtacatcaccggttctctcctagaagcaaccacatctttaggagcacgaagtggcctt
ctcaatacttttggaggatccactggacgaatgatgatgaaagaacgccaaccgggcacc
tctatggccaattccagtgccctcccttcaagttccgctgggatcagcaaggaactgatt
gatctgcagcccctcatccagttcccagaagaggtcgccagcatcctgatggagcaggag
cagaatatttaccgaagggtcttgccagttgactatctttgcttcttgacccgggacttg
ggcactccggaatgccagaggtctctgccctgcctcaaagcgtccatctcagcatcaatt
cttacctcccagaacggagaacacaatgcccttgaagatctcctgatgagatttaatgag
gtgagctcctgggtaacgtggctgatcctcaccgcgggctccatggaggagaagcgggaa
gtcttctcatatttggtgcatgtggccaaatgctgctggaacatgggcaactacaatgct
gtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatgtggcagttcatg
gaccagtctgacctggagaccatgaggagcctgaaggatgccatggctcagcacgaatct
tcctgtgagtacaggaaggtggtgacgcgggcactgcacatccccggctgtaaggtggtt
ccgttctgtggggtgtttctgaaggagctgtgtgaagcgcttgacggagcctccggcctc
atgaagctttgcccgaggtacaattcccaggaagaaactctagagtttgtagctgattat
agtggacaagataatttcttacaacgtgtgggacaaaatggcttaaagaattcagagaag
gagtccacagtcaacagcatctttcagatcatcagaagctgtagtcgaagtctcgagacc
gaggaggaggacagccccagtgaagggaacagctctaggaaaaattccttgaaggataaa
gccagatggcagtttataattggagatttgctagattctgaaaatgacatctttgagcag
cccaaagaatgggaccctcatggatcagaagagccacagaaggcgtttgaccatgggaca
gagctcatcccgtggtacgtgctgtctatccaagctgatgtgcaccagttcctgttgcag
ggggccacggtcatccactacgaccaggacatgcacctctctgcccgctgcttcctccgg
cttcagcctgacaatagcaccttgacctggatgaagcccaccactgcctccccagccagt
gctaaagcgaaacttggtgtacttagtaacacgtctgagcctggtaaattcccgttactg
ggcagtgctggattaagcagcctggtggagggggtcttggatctgttttcagcaaaggct
gtgtacatgggacaccctagcattgatatacacactgtgtgtgttcagaacaaactgggt
agcatgcttctctcagagactggtgtaacgctgctctatgggcttcagaccacggacaat
aggttattgcactttgtggcaccaaagcacacagctaaaatgctcttcagcggattgttg
gaactcacgaaagctgtaagaaagatgaggaagttccctgaccaaagacagcagtggctg
cggaaacaatacgtcagcctctatcaggaagatggacggtatgaaggcccaactttggct
catgctgtggagttgtttggtggcagacgatggagtactcgaaaccccagccctgggaca
tcagcaaagagtgccgagaagcccaacgtgcagagaaacaacaccttgggcataagtacc
accaagaaaaagaagaaaatcctgatgaggggtgagagtggagaggcaaccgacgatgag
atggccacccgcaaggtcaaagtgcacaaagagtgtcggagccggagcggttctgaccct
caagatgctaacgaaccagaggaatcagaggcgaatgccatcacgagccctccgaatcct
ctcccttccagaagagcccactctttgaccacggctgggtcccctaacttggcttccggg
acgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaacaagagcccg
tccagtgcttggagcagcagcagctggcacgggcggatcaaaggaggaatgaagggcttt
cagagcttcatggtttcagacagtaacatgagtttcattgaatttgttgagctgttcaaa
tcattcagtgtacggagccgcaaggacctgaaggatctctttgacatctatgctgtgcca
tgcaaccgagccggctccgagtcggccccgctctacaccaacctcacaatcgatgaaaac
accagcggtcttcagcctgacctagatttgttgaccagaaatgtctcggatttggggttg
ttcattaagagtaaacagcagctgtcagacaaccagaggcagatatccgatgccattgct
gctgcaagtatcgtgacaaacggcactgggatcgagagcacgtccctgggcatatttggg
gtaggcatactccagctcaatgacttcctagtgaattgccaaggagaacattgcacttac
gatgaaatcctcagcatcatccagaagttcgagcccagcgttagtatgtgtcatcagggc
ctaatgtcgtttgaaggatttgcaaggtttctgatggataaagataattttgcctcaaaa
aatgacgagtcacaggagaacagtagagaattgcagctgcccctctcctactactacatt
gaatcttcacacaatacctacctcacaggccatcagctcaaaggagaatcctcagtagaa
ctctacagccaggtcctcctgcaaggctgtaggagcatagagttggactgctgggatgga
gatgatgggatgcccatcatttatcatggacataccctgacaaccaagatccccttcaag
gaagtggttgaagccattgatcgaagtgccttcatcacctctgacctgccaatcatcata
tcaattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaattttcaagact
gtttttggagaaaaactggtggctaaattcttatttgagagtgatttctcagatgatcca
atgcttccctcacctgaccaacttagaagaaaagtgcttcttaaaaataagaagctgaaa
gcccatcagaccccagtggatatcttaaagcaaaaggctcatcagttagcatccatgcaa
gctcaggcatataatggcgggaatgccaaccctccacctgctaataacgaggaagaggaa
gatgaagaggacgaatatgattatgactatgaatccctctctgatgacaacattctagaa
gacagacctgaaaataaatcatgtaatgacaagcttcagtttgagtataatgaagaaatc
cccaagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtttatgacatg
gaactgggagaagaattttatcttcctcagaataaaaaggaaagcagacagattgcacca
gagctttctgacctggtcatctattgccaagcagtaaaatttccaggcctgtcaactcta
aatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatttttggcaac
aatccgggcagaatgagccctggagagacagcatcgtttaacaaaacatctggaaaaagt
tcctatgaaggaatgcgacaggcctgggaggaatcatcttcccccctcaacccaaccacg
tccctcagcgctatcattagaactcccaaatgttaccatatctcgtcgctgaatgaaaat
gccgccaagcgtctgtgtcgcaggtattcccagaaactgatccagcacaccgcctgtcag
ctgctgaggacttacccggccgccacccgcatcgactcgtccaaccccaatcctctcatg
ttctggctccatgggatacagcttgtggccctcaactaccagacagatgatctccctttg
catttaaatgctgccatgtttgaggccaacggtggctgtggttatgttttgaaaccccca
gttctgtgggacaagaactgtcccatgtatcagaagttttctcccttggaaagagacctg
gacaacatggagcctgctgtctattctttatctattgtctctggtcaaaacgtgtgcccg
agtaacagcacgggaagcccgtgtattgaagttgacgtcctgggcatgcccctggacagc
tgccacttccgcacgaagcccatccatcgaaataccctgaaccccatgtggaacgaacag
tttctcttccgggttcactttgaagatctcgtatttctccgttttgcagttgtggaaaac
aatagctcggcggtaactgctcagagggtcattccactcaaggctttaaaacgaggatat
cgacatcttcagctacgaaacctccacaatgaaatcttggagatctccagtttattcata
aacagcagaaggatggaagaaaattcctccagcaatactgtgccgtcctctttgatgttt
aatacagaagaaagaaaatgtttgcagactcacagagtcacggtgcatggggtccctggt
ccagagccctttactgttttctctataaatggaggcacaaaggcaaagcagcttctccag
caaattctggccactgaacaagacaccaaacctattgccacagactattttttgatggaa
gaaaaatatttcatatctaaagaaaagaatgaatgcaggaaacaacccttccagagagcc
attggtccagaagaagagatcatgcagattttaagcagctggtttccagaagaaggatat
gttggcaggattgtcttgaaaacccagcaggaaaacctagaagagaaaaacattgttcca
gaggacaaggaggtgatcctgagctcggaggaggagagcttctttgtccaagtgcacgac
gtttctccggagcaacctcgaacagtcatcaaagcgcctcgagtcagcacggcgcaggac
gtcattcagcagaccttatgcaaagccaaatattcctatagcatcctgagcaaccccaac
ccaagtgactatgtgcttttggaagaggtagtgaaagacacgaccaacaagaagtcttct
accccgaagtcctcccagcgggtccttttggatcaggagtgtgtgtttcaagcacaaagc
aagtggaaaggtgcaggaaaattcatccttaagctaaaggagcaggtacaggcatcccga
gaagacaaaagaaaaggcatatcttttgccagtgaattcaagaagctcaccaagtcaact
aaacagccccgaggactcacatcgccttctcaggtcttggcctcagaaagtgtccaaaac
aaggaggagaagcctgtgggcagcttgtcctccagtgacacgacagactatcgacagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system