KEGG   Equus caballus (horse): 100061976Help
Entry
100061976         CDS       T01058                                 

Gene name
KAT2B, PCAF
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100061976 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100061976 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100061976 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100061976 (KAT2B)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100061976 (KAT2B)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100061976 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 784 aa AA seqDB search
MECSEPTKDLEESASVASDGCVPPQVPKIANFFGFVGFPSGPWGRVAAGALEPAEESCKC
NGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDV
EYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNF
VQYKFSHLPSKEQQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCY
CNVPQFCDSLPRYETTKVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPK
FLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSNSSSLEQPNG
GSTSPSCKASSGLEANPGEKRKMNDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAML
GPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPR
MPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTH
LMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGC
ELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRE
TGWKPSGKEKSKEPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPM
DLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAG
LIDK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggagtgctcggagcccacaaaggacttggaggaatctgcgagtgtggcttcagatgga
tgtgtgcctcctcaggtccctaagattgctaacttctttggtttcgtgggtttcccttct
ggtccatggggcagagttgcagctggagctctggagcccgccgaggagtcttgtaaatgt
aatggctggaaaaaccccaacccttctcccacgccccccagagccgatctgcagcaaatc
atcgtcagtctaacggagtcctgcaggagttgtagccatgccctagctgcccacgtttcc
cacctggagaatgtgtcagaggaagaaatgaacagactcctgggaatagtgttggacgtg
gaatatctcttcacctgtgtccacaaggaagaagatgcagataccaaacaagtttatttc
tacctattcaagctcttgagaaagtctattttacaaagaggcaaacctgtggttgaaggc
tctttggagaagaaacccccatttgaaaaacctagtattgaacagggtgtgaataacttc
gtacagtacaaatttagtcacctgccatccaaagaacagcaaacaatagttgagttggca
aaaatgttcctaaaccgcatcaactattggcatttggaggcaccatctcaacgaagactg
cgatctcccaatgatgatatttctggatacaaagaaaactacacaaggtggctgtgttac
tgcaatgtgccacagttctgtgacagtctacctcggtatgaaaccaccaaggtgtttggg
agaacactgcttcgctccgtcttcactgttatgaggcgacaactcctggaacaagcaaga
caggaaaaagacaaactaccactcgagaaacgaactctaatcctcacccatttcccaaag
tttctgtccatgttagaagaagaagtttatagtcagaactctcccatctgggatcaggat
tttctttcagcctcttccagaaccagccagctaggaatccaaacagttatcaatccacct
cctgtggctgggacaatttcatacaattcaaactcatcttcccttgagcagccaaatgga
gggagtaccagtccttcctgcaaagcctcctctgggcttgaggcaaacccaggagaaaag
aggaaaatgaatgactctcatgttctagaggaggccaagaaaccccgagttatgggggat
attccaatggaattaatcaacgaggtcatgtctactatcacggaccctgcagcgatgctt
ggaccagagaccaattttctatcagcacattcagccagggacgaggcagccaggctggaa
gagcgcaggggtgtgattgaatttcacgtggttggcaattccctgaaccagaaacccaac
aagaagattctgatgtggctggttggtctacagaacgtgttctcccatcagctgccccgg
atgcccaaagagtacatcacacggcttgtctttgacccgaaacacaaaactcttgcttta
attaaagatggccgtgttattggtggtatctgcttccgtatgttcccatcccaaggattc
acagagattgttttctgtgctgtaacctcaaatgagcaagtcaagggctatggaacgcac
ctgatgaatcatttgaaagaatatcatataaaacatgacatcctgaacttcctcacatat
gcggatgaatatgcaattggatatttcaagaaacagggtttctccaaagaaattaaaata
cctaaaaccaaatatgttggctacatcaaggattatgaaggagccactttaatgggatgt
gagctgaatccacggatcccatatacagaattttctgtcatcattaagaagcagaaggag
ataattaaaaagctgatagaaagaaaacaagcccagattcgaaaagtctaccctggactt
tcatgttttaaagatggagttcgacagattccgatagaaagcattcctggaattagagag
acaggctggaaaccgagtggaaaagaaaaaagtaaagagcccaaagaccctgaccagctg
tatagcacgctcaagagcatcctccagcaggtgaagagccatcaaagcgcttggcccttc
atggaacctgtgaagagaactgaagctccgggatattatgaagttataaggttccccatg
gatctgaaaaccatgagcgaacgcctcaagaataggtactacgtgtctaagaaattattc
atggcagacttacagcgagtctttaccaattgcaaagagtacaacccccctgagagtgaa
tactacaaatgtgccaatatcctggagaaattcttcttcagtaaaattaaggaagctgga
ttaattgacaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system