KEGG   Equus caballus (horse): 100061976Help
Entry
100061976         CDS       T01058                                 

Gene name
KAT2B, PCAF
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:ecb04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ecb04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ecb05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 784 aa AA seqDB search
MECSEPTKDLEESASVASDGCVPPQVPKIANFFGFVGFPSGPWGRVAAGALEPAEESCKC
NGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDV
EYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNF
VQYKFSHLPSKEQQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCY
CNVPQFCDSLPRYETTKVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPK
FLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSNSSSLEQPNG
GSTSPSCKASSGLEANPGEKRKMNDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAML
GPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPR
MPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTH
LMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGC
ELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRE
TGWKPSGKEKSKEPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPM
DLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAG
LIDK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggagtgctcggagcccacaaaggacttggaggaatctgcgagtgtggcttcagatgga
tgtgtgcctcctcaggtccctaagattgctaacttctttggtttcgtgggtttcccttct
ggtccatggggcagagttgcagctggagctctggagcccgccgaggagtcttgtaaatgt
aatggctggaaaaaccccaacccttctcccacgccccccagagccgatctgcagcaaatc
atcgtcagtctaacggagtcctgcaggagttgtagccatgccctagctgcccacgtttcc
cacctggagaatgtgtcagaggaagaaatgaacagactcctgggaatagtgttggacgtg
gaatatctcttcacctgtgtccacaaggaagaagatgcagataccaaacaagtttatttc
tacctattcaagctcttgagaaagtctattttacaaagaggcaaacctgtggttgaaggc
tctttggagaagaaacccccatttgaaaaacctagtattgaacagggtgtgaataacttc
gtacagtacaaatttagtcacctgccatccaaagaacagcaaacaatagttgagttggca
aaaatgttcctaaaccgcatcaactattggcatttggaggcaccatctcaacgaagactg
cgatctcccaatgatgatatttctggatacaaagaaaactacacaaggtggctgtgttac
tgcaatgtgccacagttctgtgacagtctacctcggtatgaaaccaccaaggtgtttggg
agaacactgcttcgctccgtcttcactgttatgaggcgacaactcctggaacaagcaaga
caggaaaaagacaaactaccactcgagaaacgaactctaatcctcacccatttcccaaag
tttctgtccatgttagaagaagaagtttatagtcagaactctcccatctgggatcaggat
tttctttcagcctcttccagaaccagccagctaggaatccaaacagttatcaatccacct
cctgtggctgggacaatttcatacaattcaaactcatcttcccttgagcagccaaatgga
gggagtaccagtccttcctgcaaagcctcctctgggcttgaggcaaacccaggagaaaag
aggaaaatgaatgactctcatgttctagaggaggccaagaaaccccgagttatgggggat
attccaatggaattaatcaacgaggtcatgtctactatcacggaccctgcagcgatgctt
ggaccagagaccaattttctatcagcacattcagccagggacgaggcagccaggctggaa
gagcgcaggggtgtgattgaatttcacgtggttggcaattccctgaaccagaaacccaac
aagaagattctgatgtggctggttggtctacagaacgtgttctcccatcagctgccccgg
atgcccaaagagtacatcacacggcttgtctttgacccgaaacacaaaactcttgcttta
attaaagatggccgtgttattggtggtatctgcttccgtatgttcccatcccaaggattc
acagagattgttttctgtgctgtaacctcaaatgagcaagtcaagggctatggaacgcac
ctgatgaatcatttgaaagaatatcatataaaacatgacatcctgaacttcctcacatat
gcggatgaatatgcaattggatatttcaagaaacagggtttctccaaagaaattaaaata
cctaaaaccaaatatgttggctacatcaaggattatgaaggagccactttaatgggatgt
gagctgaatccacggatcccatatacagaattttctgtcatcattaagaagcagaaggag
ataattaaaaagctgatagaaagaaaacaagcccagattcgaaaagtctaccctggactt
tcatgttttaaagatggagttcgacagattccgatagaaagcattcctggaattagagag
acaggctggaaaccgagtggaaaagaaaaaagtaaagagcccaaagaccctgaccagctg
tatagcacgctcaagagcatcctccagcaggtgaagagccatcaaagcgcttggcccttc
atggaacctgtgaagagaactgaagctccgggatattatgaagttataaggttccccatg
gatctgaaaaccatgagcgaacgcctcaagaataggtactacgtgtctaagaaattattc
atggcagacttacagcgagtctttaccaattgcaaagagtacaacccccctgagagtgaa
tactacaaatgtgccaatatcctggagaaattcttcttcagtaaaattaaggaagctgga
ttaattgacaagtga

DBGET integrated database retrieval system