KEGG   Equus caballus (horse): 100062198Help
Entry
100062198         CDS       T01058                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100062198 (USP42)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100062198 (USP42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 1333 aa AA seqDB search
MTIVDKASESSDASTCQNQPGSSEAVSPGDMDAGSAGWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHSTHSPGQSSPRPVITQRVVNNKQAAPGFIGPQLPSHMIKNPPHLNGTGPLKETPSSS
MSSANGNSSVSRAGPVNASTSVQNWSVNRPSVIPEHPKKQKITISIHNKLPVRPGQSQPN
LHSGSLENPHKPVPSSPITASPAVQSTSSAPAAPASSKVAKQMTPAESCATPVMNGKSKL
NSSVLVPYGAESSEESDEEAKGLSKENGLGTTESSPSSAQGAEDDEASQHELLEPAALNG
ANSTDGDLKENGLSFDGASCQVQPALHSENPFSKANGLPGKLMPAPLPPLPEDKILETFK
LSNKTKGSADGTSPTRTEESPAESPEAAPEAGSPAPDARDKLQTLTSLSSKLKKALLLSE
PGSKPAKDDVAESVSAEPAEPLPSTAVLCNSSMSAAGHDQLAALCEPADLTNDPSRPSQA
AKGALLESPRDSAAMETVGRLSPSPSARAEGDGEHELSVCSGCDKCTAVEDPSKSTGASA
EESPSPQLDTITEGPPEGVPEHSNSERGEENKVAQKVQDHSPVKEKISTLRKVDRGHYRN
RRDRSSSGERARESRSKTEDRYHKKRHSYVRERAKQERYRPEHCNGSQHQPCHGERGSPS
EHRSLGRYGHHHSRNRGGSDQEWSRYHHSESEHSWGREKYYPEKMRWDKCRYYHDRYAPY
AAREVWEWKPFHGDREYDKAGQYASRPHKDYLKSRKGYELLAKEKGRHHFSSPRAGPSHV
LPLYPEKYAQEKVALVAEDNTYHLADRFHEHETVKARKRRYDSLENADSHIGKKAWRSLP
RDPLEEPKVKKHKKSKKKKKSKDKHRDRDSRHQQDSELSGAHSDADLHRHRKKKKKRKRH
SRKCEDALRDSGLRLAKAAACETVARFRRAAGGFPLAEGLPLEGAGPFRENTKAFRVESR
ADRCRLSECGQGD
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaagcttctgaatcttcagacgcatcaacctgtcagaatcagcct
ggcagttctgaggcagtctcacctggagacatggatgcaggttctgccggctggggtgct
gtgtcttcgttaaatgatgtttcaaatcacacgctttctttaggaccagtacctggtgct
gtagtttattcaagttcatctgtacctgataaatcaaaaccgtcaccacaaaaggatcaa
gccctaggtgatggcattgcccctccacagaaagttcttttcccatctgagaagatttgt
cttaagtggcagcagacgcatagagttggagctgggctccagaatttgggcaatacctgt
tttgccaacgcagcattgcagtgtttaacttacacaccgcctctcgccaattacatgcta
tcgcacgaacactccaagacatgtcatgcagaaggattttgtatgatgtgtacaatgcaa
gcacatatcacccaggcactcagtaatcctggggatgttattaaaccgatgtttgtcatt
aatgagatgcggcgaatagctaggcacttccgctttggaaaccaagaagatgcccatgaa
tttcttcaatacactgttgatgctatgcaaaaagcctgcttgaacggcagcaataaatta
gatagacacacccaggccaccacactcgtttgtcagatatttggaggatacctaagatct
agagtcaaatgtttaaattgcaaaggtgtctcagatacttttgatccatatcttgatata
acattggagataaaggctgctcagagtgttaacaaggccttggagcagtttgtgaagccg
gaacagcttgacggcgagaactcatacaagtgcagcaagtgtaaaaagatggttccagcc
tcaaagaggttcactatacatagatcctccaatgttctcacactttctctgaaacgcttt
gcaaattttactggcggaaaaattgctaaggatgtgaaataccctgagtatcttgatatt
cgaccatacatgtctcaaccaaatggagaaccaattatttatgttttgtatgcagtgctg
gtacacactggttttaattgccatgctggccattacttctgctacataaaagctagcaat
ggcctctggtatcaaatgaatgactccatcgtatctaccagtgacattagatcggtactc
agtcaacaagcttatgttctcttttatatcaggtcccatgatgtgaaaaatggaggtgaa
cttactcattccacccacagccccggccagtcctctccccgaccagtaatcactcagcgg
gtcgtcaacaacaaacaggccgcaccagggtttatcggaccacagcttccttctcatatg
ataaagaacccacctcacttaaatgggaccggaccattgaaggagacgccgagcagttcc
atgtcgagtgctaacggaaattccagcgtcagcagggctggtcctgttaatgcttcgact
tctgttcaaaactggtcagttaacaggccctcagttattccagaacatcccaagaaacaa
aaaatcacgatcagtattcacaacaagttgcctgttcgcccaggtcagtctcagcctaac
ctccacagcggttctttggagaacccacacaagcctgtgccctcctctcccatcaccgct
tctcccgcagtgcagtctacctccagtgcgcccgccgcgccggcctccagcaaagtagcg
aagcagatgaccccggctgagtcctgcgccacgccggtgatgaacggcaagtccaagctg
aactcaagcgtcctggtcccctatggtgccgagtcatctgaggagtcggacgaggaggcc
aagggcctcagcaaggagaacggtctgggtacgaccgagagctcgccctcttctgctcag
ggtgccgaagacgacgaggcctctcagcacgaacttctagaacctgctgctctaaatggt
gctaatagtacagacggcgacctgaaagagaacggtctgtcatttgatggtgccagttgc
caagtccagcctgctctacactcggaaaatcccttttctaaggcaaacggtctacctgga
aagttgatgcctgctcctttgccacctctcccagaagacaaaatcttagagaccttcaaa
cttagcaacaaaacgaaaggctcggcagatggaacgagtccaacccggaccgaggagagc
cctgccgagagtccggaagcagccccggaggccggcagccccgctcctgacgcccgggac
aagctgcagacgctcacgagtctcagcagcaagctgaagaaggctctgctgctctcggag
cccggcagcaaacccgccaaagacgacgtcgccgagagcgtctccgcggagcccgccgag
cctctgcccagcaccgccgtactctgtaacagcagcatgagcgccgctgggcacgatcag
ctcgccgcactctgtgagcccgcggatctgacaaacgatccgagcaggccatcgcaggcc
gcaaagggggcgttactggagagtccccgggactcagcagcgatggagacggtggggagg
ctgagcccgagtccctcagcgcgtgccgagggtgacggtgagcatgaactctcagtgtgc
agcggttgcgacaagtgcacggccgtggaggacccttccaaaagcacaggcgcgtctgca
gaggagtcgccctctcctcaactagacacgatcacagagggtcctcccgagggggtccct
gaacacagtaacagtgagagaggtgaagaaaataaggttgcgcagaaagttcaggatcat
tctccagttaaggaaaaaatcagtactcttagaaaagttgatcgaggacattatcgcaac
cgaagagatcgctcctccagtggagagcgcgcaagggaaagtaggagcaagaccgaggac
cgttatcacaaaaaacggcactcctacgtgagagagcgggctaagcaggagcgctaccgg
ccagagcactgcaacgggagccagcaccagccctgtcacggggagaggggcagccccagc
gagcaccgctccctgggcaggtacggccaccaccactctcgaaatagaggcgggtcagac
caggaatggagcaggtaccaccactcagaaagcgaacactcctggggccgggagaaatac
tacccggagaagatgaggtgggacaagtgcaggtattaccacgacaggtacgccccctac
gcggccagggaggtgtgggagtggaagcctttccacggcgaccgcgagtatgacaaggcg
ggtcagtacgccagccggccgcacaaggactacttgaaaagcaggaagggctatgagttg
cttgctaaagaaaagggccgacaccacttcagcagccctcgagcaggcccgtcccacgtc
cttcctctgtaccccgagaagtacgcccaggagaaggttgcacttgtagctgaggacaac
acttaccacctcgccgatcggtttcacgaacacgaaactgtcaaggcacggaagcggaga
tacgatagtctagaaaatgctgacagtcacataggaaagaaagcctggaggagcttacca
cgggaccctttagaagagcctaaagtgaagaagcacaaaaaatcaaagaagaaaaagaaa
tccaaagacaaacaccgcgatcgagattccaggcaccagcaggactccgagctgtcggga
gcgcactctgacgccgacctccacaggcacaggaagaagaagaagaagaggaagaggcac
tcccgcaagtgcgaggatgcgctcagagactcagggctgcgcctggccaaggccgccgcc
tgcgagactgtcgcccgcttccggagggcggccggcggcttcccgctcgccgagggcctg
cctctggagggcgccgggcctttccgcgagaacacgaaggccttccgcgtggagagcagg
gccgacaggtgtcgtctgtcggagtgcggccagggtgattga

DBGET integrated database retrieval system