KEGG   Equus caballus (horse): 100062352Help
Entry
100062352         CDS       T01058                                 

Gene name
CDC25C
Definition
cell division cycle 25C
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
ecb  Equus caballus (horse)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:ecb04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ecb04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ecb04914]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:ecb05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 550 aa AA seqDB search
MRVASSLSCHPLQNIAEGGRAQLEAYLETRGGGRVGRSESSETMSAELFSFTREPGSPGS
GPSFRSNQRKILNLLLERDTSFTVCPDLPRTPVDKLFGDSGHLSILSGGTPKCCLDLSNL
SSGEMSATQLTTSADHDETGHLNSSGPQGIQLSAMNHHQNVIKCSPAQLLCSTPNALDHS
KKKKDVICSSSTNKENENNTSRLLEWWAPRNLKFRKRPEGPYMSPLSLLDNGNLVENEMK
YLGSPITRVPKLDKNPELEDQTEEFSDELMEFSLDDQEEAKASLNRSRLYRSPSLPENLN
RPILKQVVKFKDNPIPDKVKKKYCSSHRELRKGLGLKKTVSLCDVNITHMLEEDSNQGHL
IGDFSKVCVLPTVSGRHQDLKYVNPETVAALLSGKFQGLIEKFYIIDCRYPYEYLGGHIQ
GALNLYSQEELYNFFLKKPVVPLDTQKRIIIVFHCEFSSERGPRMCRSLREEDRALNRYP
ALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKAELLRCRSQNKAWEGERQLQE
QIALLVKDLL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggcttcctcactatcgtgtcaccccctccaaaatattgcagaaggtggacgg
gcccagttggaggcatatctcgaaacccgcgggggaggccgtgtcggacgaagtgagagc
tcggagaccatgtctgcagaactcttctcattcacgagagagccaggaagccctggctca
ggacctagttttagatccaatcagaggaagatattaaacctgctcctggagagagacact
tcctttaccgtctgtccagatctccctagaacgccagtggacaaactctttggtgattct
ggacacctaagcattttgtctggaggaaccccaaaatgttgccttgatctttcgaatctt
agcagtggagagatgtctgccactcagcttaccacttctgcagaccatgatgaaactggt
cacttgaattcttcaggacctcaggggatacaattatctgcgatgaatcatcaccagaac
gttataaaatgcagcccagcacagctgctttgtagcactccaaatgccttggaccacagc
aagaagaagaaagatgtgatatgtagctcatccacaaataaggaaaatgaaaacaacact
tcgaggcttttagagtggtgggcacccaggaacctgaagtttcgaaagagaccagagggg
ccttatatgtctccgctttctctactggacaatggaaacttggtggaaaatgaaatgaaa
tatctgggcagccccattactagagttccaaaactggataaaaatccagaactagaagac
cagacagaggagttttcagatgaattgatggagttttccctggatgatcaagaagaggcc
aaggcatctctgaacagaagcaggctgtatcgctctccttcattgccagagaatttgaac
aggccaatactgaagcaggtggtaaaattcaaggacaacccaataccagataaagtaaag
aagaagtattgttctagccacagagagctcaggaagggcttaggtctaaagaagacagtc
tctctctgtgacgttaatatcactcacatgttggaggaagattctaaccaggggcatctg
attggtgatttctccaaggtatgtgtgctgccaaccgtgtcagggagacaccaagatctg
aagtacgtcaacccagaaacagtggctgccttgctgtcggggaagttccagggtctgatt
gagaagttttatatcattgattgccgctatccatatgagtacctgggaggacacatccag
ggagccttaaacttgtacagtcaggaagaactgtataacttctttctgaagaagcccgtt
gtccctttggacacccagaaaagaataatcatcgtgttccactgtgaattctcctcagag
aggggtccccgaatgtgccgctctctgagagaagaggacagggctctgaaccggtatcct
gcattgtactacccagagctatatatcctcaaagggggctacagagatttctttccagaa
tatatggagctatgtgaaccacagagctactgccctatgcatcaccaggaccataaggct
gagctgctgaggtgtcggagccagaacaaagcatgggaaggggagcggcagctgcaggag
cagattgccttgctggtgaaagaccttttgtga

DBGET integrated database retrieval system