KEGG   Equus caballus (horse): 100062506Help
Entry
100062506         CDS       T01058                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
ecb  Equus caballus (horse)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100062506 (APOA4)
   04977 Vitamin digestion and absorption
    100062506 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 381 aa AA seqDB search
MFLKAVVLTLALVAVTGARAEVNADQVATVVWDYFSQLSNSAKEAVEHLQKSELTQKLNT
LFQDKLEEVNTYRTDLQKRLVPFATALHERLTKDSEKLKEEIRKELEELRARLLPHADEV
SQKIGDNMRELQQRLGPHAEELRAQVSAQAEQLRRQLSPYAERMQSVLRDNARSLGASLT
PYADQLKAQINQNVEELKNRLTPYADELKVKIDQSVEQLRSQLAPYAEDAQEKLNRQLEG
LAFQMKKSAEELKAKISANADELRQKLVPLAEDVHGKLRGNPDGLQKSLAELSGHLDRQV
EEFRRRVEPYGETFSKALVQQVEELRQKLGPYAGDVEGHLSFLEKDLRDKVSSFFSTLKE
ESQDKPLALPDQEPALGPLEN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtcctgaccctggccctggtggctgtcaccggggcccgggct
gaggtcaatgctgaccaggtggccacggtggtgtgggactacttcagccagctgagcaac
agtgccaaggaggctgtggagcatctccagaagtctgagctcacccagaagctcaacacg
cttttccaggacaaacttgaggaagtgaacacctacaggaccgatctgcagaagcggctg
gtgcccttcgccacggcgctgcacgaacgcctgaccaaagactcagagaagctgaaggaa
gagattcggaaggagctggaggagctgcgggcccggctgctgccccacgccgacgaggtg
agccaaaagatcggcgacaacatgcgcgagctgcagcagcgcctgggtccccacgcggag
gaactgcgcgcccaggtcagcgcgcaagcagagcagctgcggcgccagctgagcccctac
gcggagcgcatgcagagcgtgctgcgcgacaacgcgcgcagcctgggggcctccctgacg
ccctacgccgaccagctcaaggcccagatcaaccagaacgtggaggagctcaagaaccgc
ctcacgccctacgccgacgagctcaaggtcaagatcgaccagagcgtggagcagctgcgc
agccagctggctccctacgcggaggatgcccaggagaagctgaaccgccagctcgagggc
ctggccttccagatgaagaagagcgccgaggagctgaaggccaagatctcggccaacgcc
gacgagctgcggcagaagctggtgcccctggccgaggacgtgcacggcaagctgaggggc
aaccccgacggactgcagaagtcactggccgagctgagcggccacctggaccgccaagtg
gaggaattccgccgccgtgtggagccctacggagagaccttcagcaaagctttggtgcag
caggtggaggaactcaggcagaagctgggcccgtatgcgggggacgtggaaggccacttg
agtttcctggagaaggatctgagggacaaggtcagctccttcttcagcactctcaaggag
gagagccaagacaagcccctggccctccccgatcaggagccggccctgggccccctggag
aactga

DBGET integrated database retrieval system