KEGG   Equus caballus (horse): 100062519Help
Entry
100062519         CDS       T01058                                 

Gene name
OTUD5
Definition
(RefSeq) OTU domain-containing protein 5 isoform X2
  KO
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100062519 (OTUD5)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100062519 (OTUD5)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C85
   100062519 (OTUD5)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    100062519 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
X
AA seq 566 aa AA seqDB search
MTILPKKKPPPPDSDPANEPSPPVPLPPAPRRGGGVGVGGGGTGVGGGDRDRESGVVGAR
TRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGGVGVGSCCSGPGHSKRRRQAPGVAAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPSTVLALA
KPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASV
LAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaaaccgccgcctcccgactctgaccccgctaacgagccg
tcgccgcccgtgccgctgcccccggcgccgcgccgcggcgggggtgtgggcgtgggcggc
ggcggcacgggcgtgggcggtggcgaccgcgaccgtgagtcgggcgttgtaggggcccgt
acccgggcctcgccaccgcctcagggcccgctgccggggccaccgggtgcgcttcaccgc
tgggcgctggccgtgccgccaggcgctgtggcaggcccccggccacagcaggcctctcct
cctccttgcgggggccctggcggtcccggcggcggtcccggtgacgcgctgggtgcagcg
gcggcaggtgtgggcgcggcgggcgtggtggtgggtgtgggcggtggtgtaggcgtgggc
agctgctgctctgggcctggtcacagcaagcggcggcgtcaagcccccggggttgccgcg
gttggcgggggcagccctgagcgtgaggaggtcggcgcgggttacaacagtgaggacgag
tatgaagcagctgcagcacgcatcgaggccatggaccctgccaccgtcgagcagcaggag
cactggtttgaaaaagccctgcgagacaagaagggcttcatcatcaagcagatgaaggag
gacggcgcctgtctcttccgggctgtcgctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcactgcatggactatctgatgaagaatgctgactacttctccaac
tatgtcacagaagacttcaccacctacatcaaccggaagcggaaaaacaattgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccggcctgtggaggtgtaccag
tacagcacagaacccatcaacacattccatgggatccatcaaaacgaggatgaacccatc
cgtgtcagctatcatcggaatatccactacaattcagtggtgaatcccaacaaggccacc
attggtgtggggttgggcctgccatcattcaaaccagggtttgcagagcagtccctgatg
aagaatgccataaaaacatcagaggagtcatggattgaacagcagatgctggaagacaag
aagcgggccacagactgggaggccacaaatgaggctattgaggagcaggtggctcgagaa
tcctacctgcagtggctgcgggatcaggagaaacaggcccgccaggtccgcggccccagc
cagccccggaaagccagcgccacctgcagttctgccacagcagcagcctccagtggcttg
gaggagtggaccagccggtccccacggcagcggagttcagcctcatcacctgagcaccct
gagctgcatgccgagctgggcatcaagcccccttccccaagcactgtcttagctcttgcc
aaacctccttcgccctgtgcaccaggtacaagcagccagttctcagcaggggccgaccgg
gctacttcccccctcgtgtccctgtaccctgctctggagtgccgagccctcattcagcag
atgtccccctccgcctttggtttgaacgactgggatgacgatgagatcctcgcatcggtg
ctggccgtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagac
ccacccccagacaagagctga

DBGET integrated database retrieval system