KEGG   Equus caballus (horse): 100063125Help
Entry
100063125         CDS       T01058                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100063125 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 263 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPDELERKVWELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPRFDTTFEMGRPTQTHMAAGCSWSAWGLLRFLVSQNVAGLQ
VRPGFPRDKLAELHGNMFVEECVKCKTQYVRDTVVGSMGLKATGRLCTMAKARGLRACRG
ELRDTILDWEDALPDRDLTLADEASRSEPRMSPGWGGRGPGRKQPAPAQGRGCQLRGGVR
GGFLEEAALSGPHLPVITAAPVY
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggttgtcgccgtacgcggacaagggcaagtgcggcctt
cccgagatctttgaccccccagacgagttggagcggaaggtgtgggagctggcacagctg
gtctggcagtcctccaacgtggtgttccacacgggcgcaggcatcagcaccgcctcgggc
atccctgacttcaggggtccccatggcgtctggacaatggaggagcggggcctggccccc
aggttcgacacgaccttcgagatgggccggcccactcagacgcacatggcggctgggtgc
agctggagcgcgtggggcctcctgcgcttcctggtcagccagaacgtggccggtctccag
gtgcggcccgggtttcccagggacaagctggcagagctgcacgggaacatgtttgtagaa
gaatgtgtcaagtgtaagacgcagtacgtccgggacaccgtcgtgggcagcatgggcctc
aaggccacgggccggctgtgcaccatggccaaggccagggggctgcgggcctgcagaggg
gagctgagagacaccatcctcgactgggaagatgctctgcctgacagggacctcactctc
gccgacgaggccagcaggtctgagccccggatgagcccagggtggggcgggcggggacct
gggcggaaacagccagcgccagcccagggcaggggatgccagctcagagggggagtcaga
ggaggcttcctggaggaggcggccctctctgggcctcacttgcccgtaataacagcagct
cctgtgtactga

DBGET integrated database retrieval system