KEGG   Equus caballus (horse): 100063383Help
Entry
100063383         CDS       T01058                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK isoform X3
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04064  NF-kappa B signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04380  Osteoclast differentiation
ecb04611  Platelet activation
ecb04625  C-type lectin receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb05152  Tuberculosis
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100063383 (SYK)
   04072 Phospholipase D signaling pathway
    100063383 (SYK)
   04151 PI3K-Akt signaling pathway
    100063383 (SYK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100063383 (SYK)
   04625 C-type lectin receptor signaling pathway
    100063383 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    100063383 (SYK)
   04662 B cell receptor signaling pathway
    100063383 (SYK)
   04664 Fc epsilon RI signaling pathway
    100063383 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    100063383 (SYK)
  Development
   04380 Osteoclast differentiation
    100063383 (SYK)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100063383 (SYK)
  Infectious diseases
   05152 Tuberculosis
    100063383 (SYK)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100063383 (SYK)
   05169 Epstein-Barr virus infection
    100063383 (SYK)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100063383 (SYK)
Protein kinases [BR:ecb01001]
 Non-receptor tyrosine kinases
  SYK family
   100063383 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100063383
NCBI-ProteinID: XP_005605142
Ensembl: ENSECAG00000009488
Position
23
AA seq 349 aa AA seqDB search
MKLSALENSQEHGEAAAPGSSSSQGNHPESSATSNPYELDRGTSATERDAQREAMPMDTE
VYESPYADPEEIRPKEVYLDRNLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKN
EANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHV
KDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADESYY
KAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLE
KGERMGCPAGCPREMYELMKLCWTYEVENRPGFVAVELRLRNYYYDVVN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctctgctctggagaacagtcaagagcatggagaggctgcagcccccgggagc
tcctcttcccaagggaaccaccccgagagttctgcgacgtccaacccttatgagctagac
cgagggacctcggccaccgaaagagatgcccagagagaagccatgcccatggacaccgaa
gtgtacgaaagcccctatgcggacccggaggagatcaggcccaaggaggtctacctggat
cgaaacctgctgaccctggaggacaacgagctgggctctggtaactttgggaccgtgaag
aagggttactaccagatgaaaaaggtcgtgaaaacagtggctgtgaaaatcctgaaaaat
gaggccaatgaccctgctcttaaagatgagttattagcagaagccaatgtcatgcagcaa
ctcgacaatccttacatcgtgcgtatgatcgggatctgtgaagccgagtcctggatgctg
gtcatggagatggcggaactgggtccactcaataaatatttacagcagaacaggcatgtc
aaggataagaacatcatcgagctggttcatcaggtttctatgggaatgaaatatttggag
gagtccaattttgtgcacagagatctggctgcaagaaatgtattgctggttactcaacat
tatgccaagatcagtgattttggactttccaaagcacttcgtgctgatgaaagctactac
aaggcccagacccacgggaagtggcccgtgaagtggtatgctccagaatgcatcaactac
tacaagttctccagcaagagtgacgtctggagcttcggcgtgttgatgtgggaagccttt
tcctatgggcagaagccgtaccggggaatgaaagggagtgaagtttccgcaatgctggag
aaaggagagaggatgggctgccccgcggggtgtcccagagagatgtatgagctgatgaag
ctgtgctggacctatgaggtggagaacaggccgggattcgtggcggtggagctgcggctg
cgcaattactactatgacgtggtgaactga

DBGET integrated database retrieval system