KEGG   Equus caballus (horse): 100063449Help
Entry
100063449         CDS       T01058                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  
thrombospondin 2/3/4/5
Organism
ecb  Equus caballus (horse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100063449 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100063449 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100063449 (THBS3)
  Cellular commiunity
   04510 Focal adhesion
    100063449 (THBS3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100063449 (THBS3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100063449 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100063449 (THBS3)
  Exosomal proteins of bladder cancer cells
   100063449 (THBS3)
Cell adhesion molecules and their ligands [BR:ecb04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100063449 (THBS3)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100063449 (THBS3)
   VNR
     100063449 (THBS3)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100063449 (THBS3)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100063449 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1036 aa AA seqDB search
METKQGRWRRPERGLVGAWVGEGRWGSLAVALVTGTVAPLRLIRVTACPPVPPVFPVWPP
APGLSAAACLPGVVSPLERHARRRTFGGPWLFLLLCTFASASQDLQVIDLLTVGESRQMV
AVAEKIRTALLTAGDIYLLSTFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRY
QREDGKVHAVNLQQAGLADGRTHTALLRLRGPSRPSPALQLYVDCKLGDQHAGLPALAPI
PPAEVDGLEIRTGQKAYLRMQGFVESMKMILGGSMARVGALSECPFQGDESIHSAVTNAL
HSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSP
NPCFRGVDCMEVYEYPGYRCGPCPPGLQGNGTHCTDINECAHADPCFPGSSCINTMPGFH
CEACPRGYKGTRVSGVGIDYARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPC
RLGFVGNQSQGCLPARTCRSPAHSPCHVHAHCLFERNGAVSCSCNVGWAGNGNVCGPDTD
IDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCR
LFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPK
VPNPLQTDRDEDGVGDACDSCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCP
QLPNSSQLDSDNDGLGDECDVDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCE
DDFDNDAVVDPLDVCPESAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMN
SDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQAT
PFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQ
LLHRPQVGYIRVKLYEGPQLVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTV
PEDFEPFRRQLLQGRV
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaacaggggcggtggcggcggccggagcgaggcctggttggagcctgggtg
ggggaggggaggtggggctcgctggctgttgccttggtaacgggaactgtggcgcccctc
cgcctcatccgggtcacggcctgcccaccagtacccccagtgttcccagtctggcccccg
gcccctggcctgtccgccgccgcctgcctgccaggggtagtgagcccgcttgagcggcat
gcgagacgcaggaccttcggggggccctggctctttctcctcctttgcactttcgcatct
gccagtcaggacctgcaggtgattgacctgctgactgtgggcgagtcccggcagatggta
gctgtggcagagaagatccggacagccctgctcaccgctggggacatctacctcttgtcc
accttccgcctgccccccaagcagggtggtgtcctgtttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtaggcaagatcaacaaagtgctggtgcggtac
cagcgggaggatggcaaagtccatgcagtgaacctacagcaagcaggcctggccgacggg
cgcacacacacggctctcctgcgactccgaggcccgtcccgccccagccctgccctgcag
ctctatgtggactgcaaactgggtgaccagcatgctggccttccggcactggcccccatt
cctccagcggaggttgatgggctggagattaggactggacagaaggcttatttgaggatg
cagggcttcgtggaatctatgaaaatgattctgggtgggtccatggcccgggttggagcc
ctgagtgagtgtccgttccagggggatgaatccatccacagtgcagtgaccaatgcactc
cattccatcctcggagagcagaccaaggcgctggtcacccaacttaccctcttcaaccag
atcctggtggagctgcgggatgatatccgagaccaggtgaaggaaatgtccttgatccga
aacaccatcatggagtgtcaggtgtgcggcttccacgagcagcgctcccactgcagcccc
aacccctgcttccgcggcgtggactgcatggaagtgtatgagtaccccggctaccgctgt
gggccctgtccccctggcctgcagggcaacggcacccactgcactgacatcaatgagtgt
gctcatgctgacccttgttttccgggctccagctgcatcaacaccatgcctggcttccac
tgcgaggcctgtcctcgaggctacaaaggcacccgggtgtctggtgtgggcattgactac
gcccgggccagcaaacaggtctgcaatgatgttgatgaatgcaatgatggtaacaatggt
ggctgtgacccaaactccatctgcaccaataccgtgggctctttcaagtgtggtccctgt
cgcctgggcttcgtgggcaaccagagccagggctgccttccagcccggacatgccgcagc
ccagcccacagcccctgccatgtccacgcacactgtctctttgaacgcaatggtgcagtg
tcctgctcgtgtaatgtgggctgggccgggaatgggaacgtgtgtgggcctgacacggac
attgatggctacccagaccaggcgctgccctgcatggacaacaacaaacactgcaaacag
gacaactgccttttgacacccaactctgggcaggaagatgctgataatgatggtgtgggg
gaccagtgtgatgatgatgctgatggggatgggatcaagaatgttgaggacaactgccgg
ctgttccccaacaaggaccagcaaaactcagatacagattcatttggtgacgcctgtgac
aactgccccaatgttcccaacaacgaccagaaggacacagatggcaatggggaaggagat
gcctgtgacaacgacgtggatggggatggcatccccaatggattggacaattgccctaaa
gtccccaatcccctacagacagacagggatgaggatggggtgggagatgcctgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgacaccaatgaagacagcgatggggatggacatcaggacacaaaggacaactgccca
cagctgcccaacagctcccagctggactcagacaatgacggacttggagatgagtgtgat
gtggacgatgacaatgatggtgtcccagattatgtgcctcctggtcctgataactgtcgc
ctggtaccaaatccaaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgcagtcgttgaccccctggatgtgtgccctgaaagtgcagag
gtaaccctcacagattttcgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgacccaaactgggtcgtgctcaaccagggcatggaaatcgttcaaaccatgaat
agtgatcccggcctggcagttggatatacagccttcaatggcgtggactttgaaggcacc
ttccatgtgaacacagtgactgatgatgactatgcaggctttctcttcagctatcaggac
agcggccgcttctacgtggtcatgtggaaacaaacggaacagacctactggcaggccaca
cctttccgggctgtggcccagcccgggctgcagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctccggaatgctctgtggcatactggccacacccctgatcaggtacga
ctgctgtggactgacccacgaaatgtgggctggcgtgacaagacctcctaccgctggcag
ctgctgcaccggcctcaagttggctacattcgggtgaagctctatgagggtccccagcta
gtggcggattctggggtgatcattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtg
cccgaggattttgagccattccggaggcagctgctccagggaagagtgtga

DBGET integrated database retrieval system