KEGG   Equus caballus (horse): 100063532Help
Entry
100063532         CDS       T01058                                 

Gene name
MAPK14
Definition
mitogen-activated protein kinase 14
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ecb04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ecb04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ecb04370]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:ecb04668]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ecb04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ecb04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:ecb04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:ecb04622]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ecb04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:ecb04664]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:ecb04670]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ecb04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ecb04914]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:ecb04917]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:ecb04261]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:ecb04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:ecb04723]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:ecb04722]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ecb04750]
Organismal Systems; Development; Osteoclast differentiation [PATH:ecb04380]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:ecb05205]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:ecb05014]
Human Diseases; Infectious diseases; Salmonella infection [PATH:ecb05132]
Human Diseases; Infectious diseases; Pertussis [PATH:ecb05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ecb05152]
Human Diseases; Infectious diseases; Influenza A [PATH:ecb05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:ecb05160]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ecb05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ecb05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:ecb05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:ecb05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 722 aa AA seqDB search
MGGRERLAQQTTSAPPDNADDQAGKDSACKTHALSLVIAVPRGFSNVETVALREKLPGTT
VIHSFHKHSPSARGAPGAAGDGRSPSRCDRRLAPRTRPPAARSPGSPGVPGGGSPASPAA
AGVRALQSDAAPAGLVAPSTRTPAVPEPLRPNPRALGRAGGGQEQGARKGSRGGGGGEQG
TALQYLCRAGPLPGPPGPPLASRFDHSCLRAYWVPASRPRFMQCSAAGDYPKFKDRLALF
PTLYLSLSLSPLEPGICPADHGSILGKISARGESRELFSREYGGRLLFAGSGTANTGKLT
GRCNWSGGPGGSCPERAVELKIPTLSRGARCQLERCVSDSVESVFPFCRAGVGAVPAGAR
PGSGPGDKTGCSLGARETHIRWAPSGSKVISNAGSAAFDTKTGLRVAVKKLSRPFQSIIH
AKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTD
DHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVA
TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHLDQLTQILKVTGVPGA
EFVQKLKDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDLLEKMLELDVDKRLTASQALT
HPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMK
LQ
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtcgggagaggctcgcgcagcagaccacttctgcgcctcctgacaacgcagac
gaccaagctggaaaggattcagcttgcaaaacgcacgcattgtcccttgtcattgccgtt
ccacgcggcttttcaaatgtagagacagtagctctgagagagaagctcccagggacgact
gtcattcattcattccacaaacattcaccgagcgcccgcggcgcgcctggcgctgccggt
gacggacgcagcccctcccggtgtgaccggcggctggcccctcgcacccggccgcccgca
gcccgcagccccgggtccccgggcgtccccggcggcggctcacctgcttccccggctgcg
gcgggagtgcgggcgctgcagtcggacgcggccccagccgggctggtggcgccgtccacg
cggacgccggcggttcccgagccgttgcggccgaacccgcgggcgttggggcgggcgggc
gggggacaagagcaaggggcgaggaaggggagcaggggcggcgggggcggggagcagggt
accgccctccagtacctgtgccgtgcgggccccctccctgggccacccgggcctccactc
gcctcgaggtttgaccactcttgcttgagggcctactgggtgccggcctcgcgcccgcgc
ttcatgcagtgctcggctgctggtgactacccgaagttcaaagatcgtttggctcttttc
ccgacgctctatttgtcactgtcgctttcccccttggaaccaggcatttgccccgccgac
cacggttccatattgggtaaaatctcggctcgcggagagtcccgggagctgttctcgcga
gagtacggcgggaggctcctgttcgctggctctggaacggcgaacactggaaaactcacc
gggcgctgcaactggagcggtggtcccggcgggagctgcccggaacgagccgtggagctt
aaaataccgactttatctcggggagcgcggtgccagcttgagcggtgcgtttccgattct
gtcgaaagtgtatttcctttctgcagagcgggggtgggtgcagtgcctgcaggagctcgg
cctggctcgggaccaggggacaaaacgggctgctcccttggagcaagggagactcacatc
cgctgggcgccctcaggatcaaaagttattagcaatgctgggagtgctgcttttgacaca
aaaactgggttacgtgtggcagtgaagaagctatccagaccgtttcagtccattattcat
gccaaaaggacctacagagaactacggttacttaaacacatgaaacatgaaaatgtgatt
ggtctgttggatgtttttacacctgcaaggtctctggaggaattcaatgatgtgtatctg
gtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcagaagcttacagat
gaccatgttcagtttcttatctaccaaattctccgaggtctcaagtatatacattcagcc
gacataattcacagggacctaaaacctagtaatctagctgtgaatgaagactgcgagctg
aagatcttggattttggactggctcgacatacagatgatgaaatgacaggctatgtggcc
actaggtggtacagggctcctgagatcatgctgaactggatgcattacaaccagacagtt
gatatttggtcggtgggatgcataatggcggagctgttgactggaagaacgttgtttcct
ggcacagaccacctggaccagctgacccagatcctgaaagtgactggcgtgccgggcgca
gagtttgtgcagaagttgaaggacaaagcggccaaatcctacatccaggccctgccacag
agccccaagaaggatttctctcagctcttcccccgcgccagcccccaggctatagacctg
ctggagaagatgctggagctggatgtggacaagcgcctgacggcctcgcaggccctcacc
caccccttctttgagcccttccgggaccccgaggaggagacagaggcccagcagccattc
gatgattccttagaacacgagaaactcacggtggatgaatggaagcagcacatctacaag
gagattgtgaacttcagccccatcgcccggaaggactcgcggcgccggagtggcatgaag
ctccagtga

DBGET integrated database retrieval system