KEGG   Equus caballus (horse): 100063546Help
Entry
100063546         CDS       T01058                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100063546 (CLK2)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100063546 (CLK2)
Spliceosome [BR:ecb03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100063546 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 499 aa AA seqDB search
MPHPRRYHSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRAYDRRYCGSYRRNDYSRDRGEAYYDADYRHSYEYQRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCV
DHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCI
SFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNS
DYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQP
CDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDW
DENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFAR
LRAEPPSAKLWDSSRDISR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatccccgaaggtaccactcctcagagcgaggcagccgggggagttaccatgaa
cactatcggagccgaaagcataagagacgaagaagccgctcctggtcaagtagcagtgac
cggacacgacggcgccggcgggaagacagctaccatgtccgttcccggagcagctatgat
gaccgttcatcagaccggagggcatatgaccggcgatactgtggcagctacaggcgcaac
gactacagccgggatcggggagaagcctactatgatgcagactaccggcattcctacgag
tatcagcgggagaacagcagttaccgcagccagcgcagcagccggaggaagcacagacgg
cggaggcgacgcagccggacattcagccgctcatcttcgcacagcagccggagagccaag
agtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaagag
cgatatgaaattgtaagcaccttgggagaggggacctttggccgagttgtacaatgtgtc
gaccatcgcaggggtggcgctcgagttgccctaaagatcattaagaatgtggaaaagtac
aaggaagcagctcgacttgaaatcaacgtgctggagaagatcaatgagaaggaccctgac
aacaagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgtatc
tcctttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctgccc
taccccatccaccaagtgcgccacatggccttccagctgtgccaggccgtcaagttcctc
catgataacaagctgacacatacggacctcaagcctgaaaatattctgtttgtgaattca
gactacgagctcacctacaacctagagaagaagcgagatgagcgcagtgtaaagagcaca
gctgtgcgggtggtagactttggcagtgccacctttgaccatgaacaccatagtaccatt
gtttccactcgccattaccgagcaccagaggtcatcctcgagttgggctggtcacagcct
tgtgatgtgtggagcataggctgcatcatcttcgagtactatgttggcttcaccctcttc
caaacccatgacaacagagagcatctagccatgatggaaaggatcttgggtcctatccct
tcccggatgattcgaaagacaaggaagcagaaatatttttatcggggtcgcctggattgg
gatgagaacacatcagctgggcgttacgttcgagaaaactgcaaaccactgcggcgatat
ctgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgctagag
tatgagcctgctaagcgactgaccttgggtgaagcccttcagcatcctttcttcgcccgc
cttcgggctgagccacccagcgccaagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system