KEGG   Equus caballus (horse): 100063632Help
Entry
100063632         CDS       T01058                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ecb  Equus caballus (horse)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ecb00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLAVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHVKLQHHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVNLKHSMTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKFHHCRDEPLHALYDSVEKLFPGFEIETVKSNLRILFD
NAIKKRLMTHRRIGCLLSGGLDSSLVAATLLKQLKAAQVQYPLQTFAIGMEDSPDLLAAR
KVANHIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDSDLIPKEILWRPKEAFSDGITSVKNS
WFRILQEYVEHQVDDTMMAAAAQKFPFNTPKTKEGYYYRQIFERHYPGRADWLTHYWMPR
WINATDPSARTLTHYKSAAKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatctgggccctctttggcagcgatgactgccttgctgttcagtgtctgagt
gctatgaagattgcacacaggggtccagatgcatttcgttttgagaatgtcaatggatac
accaactgctgctttggatttcaccggttggctgtggttgaccagctgtttggaatgcag
ccaattcgagtgaagaaatatccttatttgtggctctgttacaacggtgaaatctacaac
cacgtgaagttgcaacaccattttgaatttgagtaccagaccaaagtggatggtgagata
atccttcatctttatgacaaaggaggaattgagcaaacagtttgtatgttggacggggtg
tttgcatttattttactggataccgccaataagaaagtgttcctgggcagagatacctat
ggagtcagacctttgtttaaagccatgacagaagatgggtttttggcagtgtgttcagaa
gctaaaggtctcgttaacctgaagcactccatgactccttttttaaaagtggagcctttt
ctcccaggacactatgaagttttggatttaaagccaaatggcaaagttgcctcagtggaa
atggttaaatttcatcactgtagagatgagcctctgcatgccctctatgacagtgtggag
aaactgttcccaggttttgagatagaaactgtgaagagcaacctgcgcatcctttttgac
aatgccattaagaaacgtttgatgacgcacagaagaattggctgccttttatcagggggc
ttggactccagtttggttgctgccactctgttgaagcagctaaaagcagcccaagtacag
tatcctctgcagacttttgcgatcggcatggaagacagtcctgatttactagctgctaga
aaggtggcaaatcatattgggagtgaacaccatgaagtcctctttaactctgaggaaggc
attcaggccctggatgaggtcatattttctttggaaacttatgatatcactacagttcgt
gcttcagtaggtatgtacttaatttccaagtacattcggaagaacacggatagcgtggtg
atcttctctggagaaggttcggatgaacttactcagggttacatatattttcacaaggct
ccttcgcctgagaaagccgaggaggagagcgagaggcttctgaaagaactctatctgttt
gacgttctccgcgcggatcgaactactgctgcccacgggcttgaattgagagtcccattc
ctggatcatcgattttcttcctattacctgtctctgccacccgatatgagaattcctaag
aatgggatagaaaaacatctcctgagagagacattcgaggactccgatctgattcctaaa
gagattctctggcgacctaaagaagccttcagtgatgggataacctcagttaagaattcc
tggtttaggattttacaggaatatgttgaacatcaggttgatgatacgatgatggcagcc
gcagcccagaaatttcccttcaacactcctaagaccaaagaaggctattactaccgtcag
atctttgagcgccactacccaggccgggctgactggctgacccattactggatgccccgg
tggatcaatgccactgacccttctgcccgcactctgacccattacaagtcagctgccaaa
gcgtag

DBGET integrated database retrieval system