KEGG   Equus caballus (horse): 100063646Help
Entry
100063646         CDS       T01058                                 

Gene name
PTPRR
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase R isoform X2
  KO
K04458  receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100063646 (PTPRR)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100063646 (PTPRR)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    100063646 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 DUF1999 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100063646
NCBI-ProteinID: XP_014584143
Position
6
AA seq 410 aa AA seqDB search
MILYRIKEKCQLSLRQDKEKNQEIHLSPITLQPAQSEAKAVGSMVQHEQLPKVLNVVVDP
QGRYAPEIKAATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGSVEPFVAVPTPREKVA
MEYLQSASRILTRSQLRDIVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPN
PLSRVCLRPKNVTDSLSTYINANYIRGYRGEEKAFIATQGPMINTVNDFWQMVWQEDSPV
IVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTVRNLVLKQGSHTQHVKHY
WYTSWPDHKTPDSAQPLLQLMLDVEDDRVASAGRGPVVVHCSAGIGRTGCFIATSIGCRQ
LKEEGAVDALNIVCQLRIDRGGMVQTSEQYEFVHHALCLYESRLAAETVQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgattctttacagaataaaagaaaaatgtcagctttccttgagacaagataaagagaaa
aatcaagagatccacctgtcacccatcacgttacaaccagcgcagtccgaggcaaaggcg
gtcggcagcatggtccagcatgagcagctcccaaaggtactgaatgtggtcgtggaccct
caaggccgatacgctcctgagatcaaagctgccacctcggtctgcccttctcctttcaaa
atgaagcccataggactgcaggagagacgaggctccaatgtgtctcttactttggacatg
agcagcttggggagcgtggaaccctttgtggctgtaccgaccccacgggagaaggtagct
atggagtacctgcagtcagccagccgaattctcaccaggtcacagctgagagacatcgtg
gcaagttcccatttactccaaagtgaattcatggaaataccaatgaactttgtggatccc
aaagaaattgacattccacgccatggaactaaaaatcgctataagaccattttgccaaat
cccctcagcagagtgtgtttaagaccaaaaaatgtaactgattctttgagcacctacatt
aatgctaattatattcggggctacagaggcgaggagaaagcgttcatcgccacgcagggc
cccatgatcaacaccgtgaacgacttctggcagatggtttggcaagaggacagtccagtg
attgttatgatcacaaaactcaaagaaaaaaatgagaagtgtgtgctctactggccggaa
aagaggggcatctatgggaaagtcgaggttctggtcatcagcgtaaacgaatgtgacaac
tacaccgttcgcaaccttgtcttaaagcaaggaagtcacacccagcacgtgaagcattac
tggtatacttcgtggcccgatcacaagacgccagacagtgcccagccccttctgcagctc
atgctggatgtggaagatgacagagttgcttccgcgggccgagggcctgtggttgtccac
tgcagcgccggcataggaaggacgggctgtttcatcgccacatccattggctgtcgacag
ctgaaagaggaaggcgctgtggacgcactcaacatcgtctgccagcttcgcatagacagg
ggtggcatggtccaaaccagcgagcagtacgagttcgtgcaccacgctctgtgtctgtac
gagagccgacttgcggcagaaaccgtccagtga

DBGET integrated database retrieval system