KEGG   Equus caballus (horse): 100063802Help
Entry
100063802         CDS       T01058                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Class
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 419 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMATEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttctagttgaatacaagagtgcagtggagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgagaatgacattagaactttctttcctgaatatacccatcaactcttt
ggggatgacgaaactgcttttggttacaagggtctgaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaggttgatgagaactttgac
tgtgtagaggcagatgatgtcgaaggcaaaattagacaaattattccacctggattttgc
acaaacacaaatgattttctttctttactggaaaaagaagttgatttcaagccatttgga
accttactccatacatactctgttctcagtccaacaggaggagaaaactttacttttcag
atatacaaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgatattgactccatttcaaggtcaaggccatggtgcccaacttcttgaaacagtt
catagatactacattgcatctccctctgttcttgatattacagcggaagatccatccaaa
agctatgtgaaattaagagactttgtgcttgtgaagctttgtcaagatttgccctgtttt
tcccgggaaaagttaatgcaaggattcaatgaagatatggcaacagaggcacaacagaag
ttcaaaataaataagcaacatgctagacgggtttatgaaattcttagactactggtaact
gacatgagtgatgctgaacaatacagaagctatagactggatattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaaaatgagaaaatgtctcagaccagaa
gaactgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacagctggaagaa
agctttcaggaacttgtggaagattaccgacgcgttattgaacgcctggctcaagagtaa

DBGET integrated database retrieval system