KEGG   Equus caballus (horse): 100063865Help
Entry
100063865         CDS       T01058                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ecb  Equus caballus (horse)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:ecb00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 367 aa AA seqDB search
MASKSWLNFLTFLCGSAIGFVLCSQLFNILLGEQVDTQPNILHNDPHARHSDDDGQNHLE
GQMNFNADASQHKDENTDIAESLYQKVKILCWVMTGPQNLEKKAKHVKATWAQHCNKVLF
MSSEENKDFPTIGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYSPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTEKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPKNVLKEISQKYKSEDPKVKL
ESLERKT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaaccttcctctgtggatcagcaattggattt
gttttatgttctcagctatttaatattttgttgggagagcaagttgacacccagcctaat
attcttcataatgaccctcatgctaggcattcagatgatgatggacagaatcatctagaa
ggacagatgaacttcaatgcagatgctagccaacataaagatgagaacacagacatcgct
gaaagcctctatcaaaaggttaaaattctttgctgggttatgacagggcctcaaaatcta
gagaaaaaggccaaacatgtcaaagctacatgggcccagcattgtaataaagtgttgttt
atgagttcagaagaaaacaaagacttccctactataggattaaaaaccagagaaggcaga
gaccaactatactggaaaacaattaaagcttttcagtatgttcatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacatatgttatactagacaatttgaga
tggcttctctcaaagtacagccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagccttg
aagagatttgttgatgcatttaagacagaaaaatgtacacatagctcctccattgaagat
ttagcactggggagatgcatggaaattataaatgtagaagcaggagattccagagatacc
actggaaaagaaacttttcatccctttgtaccagaacatcacttaatcaagggttatcta
cctagaaccttttggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggttatttatacagatatcaacctgccttacct
aaaaatgtactaaaggaaataagtcaaaaatacaaaagtgaagatccaaaagtgaagttg
gaaagccttgaaagaaaaacataa

DBGET integrated database retrieval system