KEGG   Equus caballus (horse): 100064002Help
Entry
100064002         CDS       T01058                                 

Gene name
MAP3K12
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 12 isoform X1
  KO
K04423  mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
Module
ecb_M00688  MAPK (JNK) signaling
ecb_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100064002 (MAP3K12)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100064002 (MAP3K12)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: TKL group
  MLK family
   100064002 (MAP3K12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 100064002
NCBI-ProteinID: XP_023499435
Ensembl: ENSECAG00000010837
Position
6
AA seq 892 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTQCVLRDVVPLGGQGG
GGPSPSPGGEPPPEPFANSVLQLHEQDAGGPGGATGSPESRASRVRADEVRLQCQSGSGF
LEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGE
EVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRP
VTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTK
MSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSL
HLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWR
EEVKLHFEKIKSEGTCLHRLEEELVMRRREELRHALDIREHYERKLERANNLYMELNALM
LQLELKERELLRREQALERRCPGLLKSHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKRPD
ILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLPGLRAAVP
THEPGGLGSPGGLGGGPSAWEACPPALRGLHHDLLLRKMSSSSPDLLSAALGARARGATG
GAGDPGSPPPARGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPSDGVGLLGTGREGTAG
RGGSRAGSQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSEVELTSSQRWPQGLNMRQS
LSTFSSENPSDGEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDPPASEA
VPGPEPSSLPIPHKDLLRAEQGPPSSEDSDCDSTELDNNSGEGVQPPASLPP
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctccatgagacccgcacaccctccccttcctttgggggtttcgtgtccacc
ctaagcgaggcgtccatgcgcaagctggacccagacacttctgactgcacccctgagaag
gacctgacgcctacccagtgtgtacttcgggatgtagtgccgctcgggggccagggtggg
ggcgggcccagcccctccccaggtggagagccgccccctgagccttttgccaacagtgtc
ctgcagctacacgagcaggatgcagggggcccagggggagccactgggtcccctgagagt
cgggcctccagagttcgagcggatgaggtgcggctgcagtgccagagtggcagtggcttc
ctggaaggcctcttcggctgcctgcgccctgtctggaccatgattggcaaagcctactcc
acagagcacaagcagcagcaggaagacctttgggaggtcccctttgaggaaatcctggac
ctgcagtgggtgggctcaggggcccagggcgctgtcttcctggggcgcttccacggtgag
gaggtggctgtgaagaaagtacgggacctgaaggagactgacatcaagcacctgcgaaag
ctaaagcaccccaacatcatcaccttcaagggcgtgtgcacccaggctccctgctattgc
atcctcatggagttctgcgcccagggccagctgtatgaggtactgcgggctggccgccct
gtcaccccctccttgctggttgactggtccatgggcatcgccggtggcatgaactacctg
cacctgcacaagattatccatagagatctcaagtcccccaacatgctaatcacgtacgac
gatgtggtgaagatctccgattttggcacttccaaggagctgagtgacaagagcaccaag
atgtcctttgcagggacagtagcctggatggcccctgaagtgatccgcaatgagcctgtg
tctgagaaggtcgacatctggtcctttggtgtggtgctgtgggaactgctgactggtgag
attccctacaaagacgtggattcctccgccatcatctggggtgtgggaagcaacagtctt
catctgcctgtgccctccagttgcccagacggcttcaaaatcctgcttcgccagtgctgg
aatagcaaaccacgaaatcgcccatcattccgacagatcctgctgcatctggacatcgcc
tccgccgatgtactctccacaccccaggagacttactttaagtcccaggcagagtggcgc
gaagaggtaaagctgcactttgaaaaaattaagtcagaagggacctgtctgcaccgccta
gaagaggagctggtgatgcggaggagggaggagctcagacacgccttagacatcagggag
cactatgaacggaagctggagagagccaacaacctgtacatggaacttaatgccctgatg
ttgcagctggagctcaaggagcgggagctgctcaggagggagcaagccttagagcggagg
tgcccaggcctgctgaagtcacacccttctcgaggcctccttcatgggaacacaatggag
aagctcatcaagaaaagaaatgtcccacagaagctgtcacctcacagcaaaaggccagat
atcctcaagactgagtctttgctacctaaactagatgcagccctgagtggggtggggctt
cctgggtgtcctaagggccccccctcaccaggacggagtcgccgtggcaagacccgtcac
cgcaaggccagcgccaagggcagctgtggggacctgcctggccttcgtgcagctgtgcca
acccatgaacctgggggactaggaagcccaggggggctaggagggggaccctcagcctgg
gaagcctgtcctccagccctccgtgggctccaccatgaccttctactacgaaagatgtct
tcatcatccccagatctgctgtcagcagcactgggagcccgggcccggggggccacagga
ggagctggggatcctggctcaccacctccagcccggggtgacacccccccaagtgaaggc
tcagcgcctggctccaccagcccagattcacctgggggagccaaaggggagcctcctcca
ccagtagggcccagtgacggtgtggggctcctgggaactggaagggaagggacagcggga
cggggaggaagccgggctgggtcccagcacttgactccagctgcactgctgtacagggct
gctgtcacccggagtcagaaacgtggcatctcatcagaagaggaggaaggagaggtggac
agtgaagtagagctgacatcaagccagaggtggcctcagggcctaaatatgcgccagtca
ctatctaccttcagctcagagaatccatcagatggcgaggaaggcacagctagcgaacct
tcccccagtggcacacctgaagttggcagtaccaacacggacgagcggccagatgagcgg
tctgatgacatgtgctcccagggctcagaaatcccactagacccacctgcttcagaggca
gttcctggccctgagcccagttccttgcccatcccacacaaggacctactcagagcagag
cagggccctcccagttctgaggactcagactgtgacagcactgaactggacaacaacagt
ggcgaaggcgtgcagcccccagcctccctccctccctga

DBGET integrated database retrieval system