KEGG   Equus caballus (horse): 100064071Help
Entry
100064071         CDS       T01058                                 

Gene name
POM121L2
Definition
(RefSeq) POM121-like protein 2
  KO
K14316  nuclear pore complex protein Nup121
Organism
ecb  Equus caballus (horse)
Pathway
ecb03013  RNA transport
Module
ecb_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100064071 (POM121L2)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100064071 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POM121
Motif
Other DBs
NCBI-GeneID: 100064071
NCBI-ProteinID: XP_001495134
Position
20
AA seq 1293 aa AA seqDB search
MAIFLAFSKCKQSESDPDSASGKRPWMGPGGGSVRSLHSQQMTGAYWLQKGKGSGKGEVR
ESPSSKLGLESSWLLVPRTPPALLGSSRPGLQSCSATHPARLRLHSALRLRGTRGRKDRC
RGREPGSPRLAAAGAWRCRARWTLALRHSVNSARAAPGWRCGSRARRRALPPAEVRAEVR
APGFGLKIILGLPRPCVSSFPRGADLRTRSLGGVERPKVLALSSRPDPNRHPNTTPFGSG
WITRHQKLRESGDETLFKVTDLASLLLMGSYLGKPGPPRSSPAERCTDLPQRPVNRRPAQ
SLHQVHRVQHIHRVHPAPRHRPARRPMNWDPTNPTARVVNEAWRRFPMKRSQNSIMGPLP
SDWWESYFRRSIWSLRHPRAVWSPVTIKIAPPQRGVPPCTSPAEVINSAGSLPSEKTPDP
CAKESVLRALRECKKGKVRLEDPLFPESLDSKRRSAETRPSAFKLLRKNGVLPSFVPRPG
PLKRSLNSWSSNHSLNRRPSCYSVSSLASTHTGGLISSKRNAITSSYSSSRDLSVPWKRS
VSSVSFQIPEWPVKKKEKSRQSHSPLIPLLSNESPAAYGSSGQQNQEIPLLLSSPGNLLS
LSPPPQLGNAVPEEILALGKKAGLQWSNKARGDTTEATTDSVPETHSAIQPSLSLTVRSV
GTAPTQGKNPQLESLKKMQKSPGPLAFPQSTGEAISVGHSPLKTPNLLSPLGCSQTEPLS
GTSSDSRPTASFILLTPISPTWPPLTSQTNRSAMPPDPPAITSAALIRQSSLFGMNNPAS
HPASAFPAATSADPMSKPIFGLPPNGEIGGSLYSRISVTAAVSSTPGILTPTFKPIFGNT
EPLKTMPMIAPFSFKQTTSPATPASTHLFHGLVKATSVVTSTNSASTSEDSSFKPPLDFG
IVNVTSPMGNAYSIPSTCHTLLLGAALAFRASFSPATGFIFPPHQRPTIPTVHTVTIFSR
VLPSAIQISSSRSTANFRSMGSPLSASALVTTNQPALLSSTSNLTSTFTVPLGSNSRPPF
SLSLGATPPPAFGAADGQKQGAPQPAIGPSFSSSFMFGNSAVASPTPTAAQPAFSSTTQS
TVGGLTPSASTFHIPAGIWPDIGSTPAGFRFAQANTAGFGVVTQTYHSGACGSVFGSTAP
RPFAFGGLVTPMDCGESGISMTAPDMNSNSGAFNVGAVPSGSTSTITPFGKGWSQNSQGL
TSQSTSFVLGRASISSRKAMFGGSSMAPFAQSTLVPGPVETGLGFGLPSPPARGSGGRGS
FRSSAPSFSIGTKSKTPKNREQRRSRMHHTHKK
NT seq 3882 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttccttgcattctcaaagtgcaaacaatcggaaagcgacccggattcagcc
tcggggaagcgaccctggatggggccgggaggtggcagcgtcaggagtttgcattcccag
cagatgactggcgcctactggctgcagaaaggaaagggcagcgggaaaggagaagtgcgg
gaatcgccatccagcaaattaggcctcgagtcttcctggctgctggtgccacgaacgcca
cctgcgctgctagggtcctcccgaccgggtctccagtcctgctccgcgactcaccctgcc
aggctcagactgcattccgcactccgactccggggaacccgcgggcggaaggatcggtgc
cggggccgggagcccggaagcccgaggctggccgcagccggagcctggagatgccgcgcc
cgctggactctagctctgcgccactcagtgaactcggcccgcgcggctccaggctggcgc
tgcggaagccgggcgaggcgccgcgcgctgccgccagcggaggtgagagcagaggtccga
gcgcccggcttcggcctcaaaataatactggggctgccgcggccctgcgtgtcctctttc
ccacggggcgctgacctgcgaacgcggagcctagggggtgtcgagcgcccaaaggtcctt
gccctttcctcgcgcccagatcccaaccgtcatccgaacactacgcccttcggctcaggc
tggatcaccagacatcagaaacttcgtgagtcaggagacgaaaccctattcaaagtcaca
gacctcgcctcattgctcctcatgggcagttacctgggcaagccgggacccccgcggtcg
tctccagcagagaggtgcacagacttgccccagaggccggtgaaccgccgaccagctcag
tcccttcaccaggttcaccgcgttcagcacatccatcgcgtccatcctgccccgcggcat
agacctgcgaggagaccgatgaactgggatcctaccaatcccactgcgagggtggtcaat
gaggcttggaggcgatttcccatgaaaaggtcccagaattccatcatggggcctcttccc
tcagactggtgggaaagttacttcaggcggagtatctggtctcttcggcaccccagggca
gtatggagcccggtgaccatcaagatcgctcctcctcagcggggagtgcccccctgcact
tccccagcagaggtaataaactctgcagggtccttaccctctgagaagaccccagaccca
tgtgcaaaggagtcagtgctgagggccctcagagagtgcaagaaagggaaagtgaggctg
gaagacccgctattccctgagagcttggatagtaaaagaaggagtgcagagacgagaccg
tctgcatttaaactgctgaggaagaatggagtcctcccttcttttgtgcccaggcctggt
cctctgaagagaagcctcaactcctggagttcaaaccacagcttgaataggaggcccagt
tgctactccgtgagctccttggccagcacacacacaggtggcctcatcagctccaaaaga
aatgctattacaagctcttatagctcttctagagatttgtctgttccttggaagagaagt
gtttccagtgtgtcattccagataccagagtggccagtaaaaaagaaagaaaaaagccgt
cagtctcactctccactgataccactattgtcgaatgagtccccagcagcatatggcagc
tctgggcagcaaaatcaagagattccactgctgctttctagccccgggaacctgctgtct
ctgagtccacctccccagcttggtaatgcagtccctgaagagatcttggcattagggaag
aaagctggactccaatggagcaacaaagccagaggggatacaactgaggccaccacagat
tctgtccctgagactcactctgccattcagccttccctgtctctcaccgtgcgttctgta
ggcacagctccaacccagggcaaaaatcctcagttggaaagcttaaagaaaatgcagaag
tctccaggtccactggccttcccacaatctactggagaggcaatcagtgtaggacattca
cctctgaagacacccaatctactgtctccacttgggtgctcacagacagagcccctttca
ggcacctcttcagactctaggcccacagctagtttcatccttctgacccctatttctccc
acatggccacctttgacctctcagactaataggtctgccatgcccccagacccacctgcc
attacctctgcagcgctcattaggcaaagttctttgtttggaatgaataacccagcttct
catcctgcatctgcatttcctgctgcaacttctgctgaccccatgtcaaaacccattttt
ggtctcccacccaacggtgagattggaggctccttatattccagaatttcagtcacagct
gcagtatcttcaactccgggtatcttaactcccaccttcaagcctatctttggcaacaca
gaaccacttaaaactatgcccatgatagctcctttctctttcaagcagaccacttctcca
gctactcctgcttctacccacctcttccatggcctggtcaaggctacctctgtagtcacg
tccaccaactcagctagcacatctgaagactcttctttcaagccacctttggattttggt
atagtgaatgttaccagtcccatgggcaacgcttactccatcccttccacttgccacact
ctccttcttggggctgcccttgccttcagagccagcttctccccagccacaggcttcatt
ttcccaccacaccaacgtcctaccattcctactgtacatacagtcaccattttcagccgg
gttcttcccagtgctatccagatatcctctagtagaagcactgccaattttagaagtatg
ggcagccctctgtcagcctcagccctagtaaccacaaaccagcctgcactgttgtccagt
acctccaatttgacctccacatttacagttcccttggggtcaaactcaaggccacctttc
tcactatccctaggagccacgcccccgcctgcatttggggctgcagatgggcagaagcaa
ggggccccccaaccagccattggcccaagcttcagtagctctttcatgtttggaaattca
gcagtggcatccccaaccccaaccgcagcccagccagccttcagcagtaccacacagtca
accgtcgggggtttgacaccctcagcctccacctttcacatccctgccggcatctggcca
gacattggcagcactccagcaggttttcgctttgctcaagctaatacagctggctttgga
gttgtcacccagacctaccatagtggggcttgtggctcagtgtttggcagcacagcccca
cgaccttttgcctttgggggcttagtgactcctatggactgcggggagtctggaatcagc
atgactgctccagacatgaactccaactctggagcattcaatgttggagcagtgccaagt
gggagtactagcaccatcacaccctttggaaaaggctggagccagaactcccagggcttg
accagccagagcacatcttttgtgttggggcgggctagcatttcctcaagaaaggctatg
tttgggggctcctccatggccccttttgctcagagtacccttgtccctgggccagttgaa
acaggccttggctttgggctgccctctcctcctgcccggggctctggtggaagaggatct
ttcagatcatcagctccttccttttccattggtacaaaatcaaaaaccccaaagaatcgg
gagcaaaggcgttcccgaatgcatcatacccacaagaaatag

DBGET integrated database retrieval system