KEGG   Equus caballus (horse): 100064071Help
Entry
100064071         CDS       T01058                                 

Gene name
POM121L2
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ecb03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 1026 aa AA seqDB search
MGSYLGKPGPPRSSPAERCTDLPQRPVNRRPAQSLHQVHRVQHIHRVHPAPRHRPARRPM
NWDPTNPTARVVNEAWRRFPMKRSQNSIMGPLPSDWWESYFRRSIWSLRHPRAVWSPVTI
KIAPPQRGVPPCTSPAEVINSAGSLPSEKTPDPCAKESVLRALRECKKGKVRLEDPLFPE
SLDSKRRSAETRPSAFKLLRKNGVLPSFVPRPGPLKRSLNSWSSNHSLNRRPSCYSVSSL
ASTHTGGLISSKRNAITSSYSSSRDLSVPWKRSVSSVSFQIPEWPVKKKEKSRQSHSPLI
PLLSNESPAAYGSSGQQNQEIPLLLSSPGNLLSLSPPPQLGNAVPEEILALGKKAGLQWS
NKARGDTTEATTDSVPETHSAIQPSLSLTVRSVGTAPTQGKNPQLESLKKMQKSPGPLAF
PQSTGEAISVGHSPLKTPNLLSPLGCSQTEPLSGTSSDSRPTASFILLTPISPTWPPLTS
QTNRSAMPPDPPAITSAALIRQSSLFGMNNPASHPASAFPAATSADPMSKPIFGLPPNGE
IGGSLYSRISVTAAVSSTPGILTPTFKPIFGNTEPLKTMPMIAPFSFKQTTSPATPASTH
LFHGLVKATSVVTSTNSASTSEDSSFKPPLDFGIVNVTSPMGNAYSIPSTCHTLLLGAAL
AFRASFSPATGFIFPPHQRPTIPTVHTVTIFSRVLPSAIQISSSRSTANFRSMGSPLSAS
ALVTTNQPALLSSTSNLTSTFTVPLGSNSRPPFSLSLGATPPPAFGAADGQKQGAPQPAI
GPSFSSSFMFGNSAVASPTPTAAQPAFSSTTQSTVGGLTPSASTFHIPAGIWPDIGSTPA
GFRFAQANTAGFGVVTQTYHSGACGSVFGSTAPRPFAFGGLVTPMDCGESGISMTAPDMN
SNSGAFNVGAVPSGSTSTITPFGKGWSQNSQGLTSQSTSFVLGRASISSRKAMFGGSSMA
PFAQSTLVPGPVETGLGFGLPSPPARGSGGRGSFRSSAPSFSIGTKSKTPKNREQRRSRM
HHTHKK
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttacctgggcaagccgggacccccgcggtcgtctccagcagagaggtgcaca
gacttgccccagaggccggtgaaccgccgaccagctcagtcccttcaccaggttcaccgc
gttcagcacatccatcgcgtccatcctgccccgcggcatagacctgcgaggagaccgatg
aactgggatcctaccaatcccactgcgagggtggtcaatgaggcttggaggcgatttccc
atgaaaaggtcccagaattccatcatggggcctcttccctcagactggtgggaaagttac
ttcaggcggagtatctggtctcttcggcaccccagggcagtatggagcccggtgaccatc
aagatcgctcctcctcagcggggagtgcccccctgcacttccccagcagaggtaataaac
tctgcagggtccttaccctctgagaagaccccagacccatgtgcaaaggagtcagtgctg
agggccctcagagagtgcaagaaagggaaagtgaggctggaagacccgctattccctgag
agcttggatagtaaaagaaggagtgcagagacgagaccgtctgcatttaaactgctgagg
aagaatggagtcctcccttcttttgtgcccaggcctggtcctctgaagagaagcctcaac
tcctggagttcaaaccacagcttgaataggaggcccagttgctactccgtgagctccttg
gccagcacacacacaggtggcctcatcagctccaaaagaaatgctattacaagctcttat
agctcttctagagatttgtctgttccttggaagagaagtgtttccagtgtgtcattccag
ataccagagtggccagtaaaaaagaaagaaaaaagccgtcagtctcactctccactgata
ccactattgtcgaatgagtccccagcagcatatggcagctctgggcagcaaaatcaagag
attccactgctgctttctagccccgggaacctgctgtctctgagtccacctccccagctt
ggtaatgcagtccctgaagagatcttggcattagggaagaaagctggactccaatggagc
aacaaagccagaggggatacaactgaggccaccacagattctgtccctgagactcactct
gccattcagccttccctgtctctcaccgtgcgttctgtaggcacagctccaacccagggc
aaaaatcctcagttggaaagcttaaagaaaatgcagaagtctccaggtccactggccttc
ccacaatctactggagaggcaatcagtgtaggacattcacctctgaagacacccaatcta
ctgtctccacttgggtgctcacagacagagcccctttcaggcacctcttcagactctagg
cccacagctagtttcatccttctgacccctatttctcccacatggccacctttgacctct
cagactaataggtctgccatgcccccagacccacctgccattacctctgcagcgctcatt
aggcaaagttctttgtttggaatgaataacccagcttctcatcctgcatctgcatttcct
gctgcaacttctgctgaccccatgtcaaaacccatttttggtctcccacccaacggtgag
attggaggctccttatattccagaatttcagtcacagctgcagtatcttcaactccgggt
atcttaactcccaccttcaagcctatctttggcaacacagaaccacttaaaactatgccc
atgatagctcctttctctttcaagcagaccacttctccagctactcctgcttctacccac
ctcttccatggcctggtcaaggctacctctgtagtcacgtccaccaactcagctagcaca
tctgaagactcttctttcaagccacctttggattttggtatagtgaatgttaccagtccc
atgggcaacgcttactccatcccttccacttgccacactctccttcttggggctgccctt
gccttcagagccagcttctccccagccacaggcttcattttcccaccacaccaacgtcct
accattcctactgtacatacagtcaccattttcagccgggttcttcccagtgctatccag
atatcctctagtagaagcactgccaattttagaagtatgggcagccctctgtcagcctca
gccctagtaaccacaaaccagcctgcactgttgtccagtacctccaatttgacctccaca
tttacagttcccttggggtcaaactcaaggccacctttctcactatccctaggagccacg
cccccgcctgcatttggggctgcagatgggcagaagcaaggggccccccaaccagccatt
ggcccaagcttcagtagctctttcatgtttggaaattcagcagtggcatccccaacccca
accgcagcccagccagccttcagcagtaccacacagtcaaccgtcgggggtttgacaccc
tcagcctccacctttcacatccctgccggcatctggccagacattggcagcactccagca
ggttttcgctttgctcaagctaatacagctggctttggagttgtcacccagacctaccat
agtggggcttgtggctcagtgtttggcagcacagccccacgaccttttgcctttgggggc
ttagtgactcctatggactgcggggagtctggaatcagcatgactgctccagacatgaac
tccaactctggagcattcaatgttggagcagtgccaagtgggagtactagcaccatcaca
ccctttggaaaaggctggagccagaactcccagggcttgaccagccagagcacatctttt
gtgttggggcgggctagcatttcctcaagaaaggctatgtttgggggctcctccatggcc
ccttttgctcagagtacccttgtccctgggccagttgaaacaggccttggctttgggctg
ccctctcctcctgcccggggctctggtggaagaggatctttcagatcatcagctccttcc
ttttccattggtacaaaatcaaaaaccccaaagaatcgggagcaaaggcgttcccgaatg
catcatacccacaagaaatag

DBGET integrated database retrieval system