KEGG   Equus caballus (horse): 100064091Help
Entry
100064091         CDS       T01058                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
ecb  Equus caballus (horse)
Pathway
HIF-1 signaling pathway
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:ecb04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 360 aa AA seqDB search
MFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKTID
DFTDAVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLN
QHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARRLCDLYYINSPELELEELN
AKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHYADKGVYPPIQVHVTLGKEDLTVKM
SDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLY
SLEGYGTDAVIYIKALSTESVERLPVYNKAAWKHYNANHEADDWCVPSREPKDMTTFRSA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgcggcaagagttacctgttagattggcaaatataatgaaagaaataagtctt
cttccagataatcttctcaggactccctcggttcaactggtgcaaagctggtatatccag
agtcttcaggagcttcttgattttaaggacaaaagtgctgaagatgctaaaactattgat
gactttacagacgctgtgatacggatcaggaaccgacacaatgatgttattcccacgatg
gcccagggtgtgattgaatacaaagagagcttcggggtggatcctgtcaccagccagaat
gttcagtactttctggatcgattctacatgagtcgcatttcaattcgaatgttactcaat
cagcactctttattgtttggtgggaaaggcaaaggaagcccatctcatcgaaaacacatt
ggaagcataaatccgaactgcaatgtagttgaagttattaaagatggctatgaaaatgct
aggcgtctgtgtgatttgtattatattaactctcctgaactagaacttgaagaactgaat
gcaaaatcaccaggacaaccaatacaagtggtttatgtaccatcccatctctatcacatg
gtgtttgaacttttcaagaacgcaatgagagcaacgatggaacactatgctgacaaaggt
gtttacccacctattcaagtccatgtcacactgggtaaggaggatttgactgtgaagatg
agtgaccgaggaggtggtgttcctttgaggaagattgacagactcttcaactacatgtac
tcaaccgcaccccggcctcgtgtggagacatcccgagcagtgcccctggctggttttggt
tatggattgcccatatcacgactttatgcacaatacttccaaggagacctcaagctgtat
tccctagagggttatgggacggatgcagtgatctacattaaggcgctgtccacagaatca
gtagaaagactccccgtgtataacaaagctgcctggaagcattacaacgccaaccacgag
gctgacgactggtgcgtccccagcagagaaccgaaggacatgacaacgttccgtagcgcc
tag

DBGET integrated database retrieval system