KEGG   Equus caballus (horse): 100064117Help
Entry
100064117         CDS       T01058                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M1
  KO
K04129  
muscarinic acetylcholine receptor M1
Organism
ecb  Equus caballus (horse)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100064117 (CHRM1)
   04024 cAMP signaling pathway
    100064117 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100064117 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100064117 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100064117 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100064117 (CHRM1)
G protein-coupled receptors [BR:ecb04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100064117 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
12
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEDDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKGRERAGKSQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctcggccccacccgccgtcagccccaacatcactgtcctggctcccggaaag
ggtccgtggcaagtggccttcattgggatcaccacgggcctcctgtcgctggccacagtg
acaggcaacctgctggtactcatctccttcaaggtcaacacagagctcaagacagtcaac
aactacttcctgctgagcctggcctgtgctgacctcatcattggcaccttctccatgaac
ctctacaccacatacctgctcatgggccactgggctctgggcacgctagcctgtgacctc
tggctggccctggactacgtggccagcaacgcctccgttatgaacctgctgcttatcagc
tttgaccgttacttctccgtgacccggcccctgagctaccgtgccaagcgcacaccacgc
cgggcagccctgatgatcggcttggcgtggctggtttccttcgtcctgtgggccccagcc
atcctcttctggcagtatctggtaggggagcggacagtgctggccgggcagtgctacatc
cagttcctctcccaacccatcatcacctttggcacagccatggcagccttctacctccct
gtcacggtcatgtgcacgctctactggcgcatctaccgagagacagagaaccgggcccgg
gagctagcggccctgcagggctccgagacaccagggaaggggggcggcagcagcagcagc
tcagagcggtcccagccgggggcggagggctcaccagagacccctccagggcgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaggaggaggaggac
gacgaaggctccatggagtccctcacatcctcggagggtgaggagcctggctccgaggtg
gtgatcaagatgcccatggtggaccctgaggcacaggcccctgccaaacagccaccccgg
agctccccgaatacagtcaagaggcccacccggaaagggcgtgagagagcaggcaagagc
cagaagccccgtgggaaggagcagctggccaagcggaagaccttctcgttggtcaaggag
aagaaggcggctcggaccctgagcgccatcctgctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccactttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctatgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacaccttccgcctgctgctcctctgccgctgggacaagcgt
cgctggcgcaagatccccaagcgccctggctctgtgcaccgcactccctctcgccaatgc
tga

DBGET integrated database retrieval system