KEGG   Equus caballus (horse): 100064142Help
Entry
100064142         CDS       T01058                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100064142 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100064142 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100064142 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100064142 (PLCD3)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100064142 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 803 aa AA seqDB search
MKLSLPLLPACLAFLLEPRVPVLIKDRKRGLRGSGEARGGRPQLPAQRSGAGEHPGEADP
AVPWLPTPAGLTEDEDVRAMLRGSRFRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPS
QHIFFLQHIEAVREGHQSEGLRRFGGAFAPARCLTIAFRGRRKNLDLAAPTAEEAQRWVR
GLAKLRARLDAMTQRERLDHWIHTYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYS
LFKECDHSNNERLEGTEIEEFLRRLLKRPELEEIFYKYSGEDHVLSAPELREFLEDQGED
GATLAHAQHLIQTYELNETAKQHELMTLDGFMMYLLSPNGAALDPAHMCVFQDMDQPLAH
YFISSSHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKI
LFRDVVQAVRDHAFTLSPYPVILSLENHCGLEQQAAMARHLRTILGDMLVTQALDSQNPE
ELPSPEQLKGRVLVKGKKLPAVRSEDGRILSDREEEEEEEEEEEEVEAAEQRRLAKQISP
ELSALAVYCCATRLRNLRPAPTLPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVY
PLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLINGQCGYVLKPACLRQP
DTTFDPECPGPPRTTLTIQVLTAQQLPKLNAEKPNSIVDPLVRVEIHGVPADCARKETNY
VLNNGFNPRWGQTLQFQLRAPELVLVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIH
LLSKDGASLSPATLFVHIRIQCS
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcgctgccgctgttgcctgcatgtctcgcgttcctgctggagccccgcgtg
cccgtcctgattaaggacagaaagcgaggcctgcgaggatctggagaagctcggggaggg
aggccgcagctcccagctcagaggagcggggcgggggagcatccgggcgaggccgacccc
gccgtcccttggcttcccacccccgcaggcctgacggaggacgaggacgtgcgcgccatg
ctgcggggctcccggttccgcaagatccgctcgcgcacgtggcacaaggagcgcctgtac
cggctgcaggaggacggcctgagcgtgtggttccagcggcgcatcccgcgcgcgccgtcg
cagcacatcttcttcctgcagcacatcgaggccgtccgcgagggccaccagtcggagggc
ctgcggcgcttcgggggcgccttcgcgccggcgcgctgcctcaccatcgccttcagaggc
cgccgcaagaacctggacctggcggcgcccacggccgaggaggcgcagcgctgggtgcgc
ggcctggccaagctgcgcgcgcgcctcgacgccatgacccagcgcgagcgcctcgaccac
tggatccacacctatctgcaccgggcagactccgaccaggacagtaagatgagcttcaag
gagatcaagagcctgctcagaatggtcaacgtggacatgaatgacatgtatgcctacagc
ctcttcaaggagtgtgaccactccaacaacgagcggctggaggggactgagatcgaggag
tttctgcggcggctgctgaaacgtccggagttggaggagatcttctataagtactcgggc
gaggaccatgtgctgagtgcccctgagctgcgggagttcctggaggaccagggcgaggat
ggcgccacgctagcccacgctcagcacctcatccagacctatgagctcaatgagacagcc
aagcagcatgaactgatgacactggatggcttcatgatgtacctgctgtcacccaacggg
gctgccctggacccagcccacatgtgtgtgttccaggacatggaccagccccttgcccac
tacttcatctcctcctcccacaacacctacctgaccgactctcagatcggggggcccagc
agcaccgaggcctatgttagggcctttgcccagggatgtcgctgtgtggagctggactgc
tgggaggggcctggaggggagcccgtcatctatcacggccacacgctcacctccaagatc
ctattccgagatgtggtccaggctgtgcgtgaccacgccttcacactgtccccataccct
gtcatcctgtcccttgagaaccactgtgggctggagcagcaggctgccatggcccgccac
ctccgcaccatcctgggggacatgctggtgacacaggcactggactcccagaaccctgaa
gagctgccatccccagagcagctgaagggccgggtcctggtgaaggggaagaagcttcca
gctgttcggagtgaggatggccgaattttatctgaccgggaggaggaggaagaagaggag
gaggaagaggaggaggtagaggctgcagaacagaggcggctggccaagcagatctccccg
gaactgtcagccctggctgtgtactgctgtgccacccgcctgcggaacctgcgccctgcc
cccaccctgccccagccctgccaggtcagctccctcagcgagcgcaaggccaagaagctc
atccgagaggcagggaatagcttcgtcaggcacaatgcccgccagctgacccgtgtctac
ccgctggggctgcggatgaactcggccaactacagcccccaggagatgtggaactcgggc
tgtcagctggtggccctgaacttccagacgccaggttatgagatggacctcaatgctggg
cgcttcctcatcaacggacagtgtggctacgtcctgaaacctgcctgcctgcggcagcct
gacacaacctttgaccctgagtgtcctggaccccccagaactacgctcaccatccaggtg
ctgactgcacagcagctgcccaagctgaatgccgagaagccaaactccatcgtggacccc
ctggtacgcgtggagatccatggcgtgcctgcagactgtgctcgaaaggagaccaactac
gtgctcaacaacggcttcaacccccgctgggggcagaccctgcagttccagctgcgggct
ccggagctggtgctggtccggttcgtggtagaagattatgacaccacctcccccaatgat
tttgtgggccagtttacgctgcctctcaacagcctgaagcaagggtaccgccacatccac
ctgctttccaaggatggggcctcactgtccccagccacgctcttcgtccatatccgcatc
cagtgctcctga

DBGET integrated database retrieval system