KEGG   Equus caballus (horse): 100064176Help
Entry
100064176         CDS       T01058                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 514 aa AA seqDB search
MVPVLLSLSVSCLGLWASGLILVLGFLKLLSLLLRRQKLARAMDSFPGPPTHWLFGHSLE
IQQTGSLDKVVSWAHQFPYAHPLWYGQFVGFLNIYEPDYAKAVYSRGDPKAPDVYDFLLQ
WIGKGLLVLHGPKWFQHRKLLTPGFHYDVLKPYVALFADSTRAMLDKWEEKARENKSFDI
FCDVGHMALDTLMKCTFGKADTGLGHRDSSYYQAVGELTLLTQQRIESFQYHNDFIYWLT
LHGRRFLRACRVAHDHTDQVIRERKADLQDEKEQEKIQNRRHLDFLDILLGARDEDGIKL
SDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQCCREEVREVLGDRDSFQWDDL
GKMTYLTMCIKESFRIYPPVPQVFRQLSKPVSFVDGRSLPAGSLVSLHIYALHRNSAVWP
DPEVFDPLRFSSENVARRHPFAFIPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFALDP
LRLPVPLPQLVLRSRNGIHLHLKPLGPGSGKQLC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgtgttgctctccttgagtgtgtcctgcctgggtctgtgggcttctggactg
atcttggtcttaggcttcctcaagctccttagtctgctgctgcggaggcaaaagctggcc
agggctatggacagcttcccaggaccccccacccactggctcttcggacactccctcgag
atccagcagacggggagcctggacaaggtggtgtcctgggcccaccagttcccctacgcc
cacccactctggtatgggcagttcgttggcttcctgaatatctatgagcctgactatgcc
aaagctgtatatagccgaggggaccctaaggcaccagatgtttatgacttcctccttcag
tggattgggaaaggcctgctggtccttcatgggcccaagtggttccagcaccgcaagctg
ctcacgcctggcttccattatgatgtactgaagccctatgtggccctgtttgctgactcc
acccgtgccatgctggacaagtgggaggagaaggctcgtgagaataagagctttgacatc
ttctgtgatgtgggccacatggcgctggacacgctcatgaagtgcacctttggcaaagca
gacactggcctgggtcacagggacagtagttattaccaggcagtcggtgagctcactctg
ctgacacagcagcgcatcgagtccttccagtaccacaacgacttcatctactggctcacc
ctccatggccgccgcttcctgcgtgcctgccgggtggcccacgaccacacagaccaggtc
atcagggaacggaaggcagacctgcaggacgagaaagagcaggagaagatccagaaccgg
aggcacctggacttcctggacattctcctgggggctcgtgatgaagatgggatcaagctg
tcagatgccgagctccgcgctgaggtggacacgttcatgtttgaaggccatgacaccacc
accagtggcatctcctggtttctctactgcatggccctgtaccccgagcaccagcagtgt
tgtcgggaggaggtgcgcgaggtccttggggaccgagactccttccagtgggatgatctg
ggcaagatgacctacttgaccatgtgcatcaaggagagcttccgcatctacccgcccgtg
ccccaggtgttccgccagctcagcaagcccgtcagcttcgtggatggccgctccctaccc
gcaggcagcctggtctctctgcacatctacgccctccacaggaacagcgcagtgtggccc
gaccctgaggtctttgaccccctgcgcttttcctctgagaatgtggccaggcgccacccc
tttgccttcatacccttctccgctgggcccaggaactgcatcgggcagcagtttgccatg
aacgagatgaaggtggtcacggccctctgcttgctgcgctttgagttcgccctggacccc
ttgcggctgcctgtcccgttgccccagctggtcctgcgctccaggaatggcatccatctg
cacctgaagccgctgggcccgggctctgggaagcagctctgctga

DBGET integrated database retrieval system