KEGG   Equus caballus (horse): 100064218Help
Entry
100064218         CDS       T01058                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100064218 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 2061 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTGTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLLPPTPISGQSPSSQKSSTSTSSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISVKQESTDINVVGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSSVTT
ETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGEKPPLRKAFQHQPGKKRQTGEE
EGKDNRCFKNSDPCRNNMDDDANNLKEGSRDNPEPLKCKQVWPKGTKHGLSKWRPNKERK
TGFKLNLYTPPETPMEPDDQVTVEEQKETPEDKTSPTSTRIEEEVEEAVEPLLPRDENRR
EETCAPISPNKSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEEEGNVEKDPGGAKSQEKE
EPEVCMDKEDSVRLDDHEEEEEEDEEPSHNEGHDADDEDDSHMESAEAEKKEHPREAFKE
VLENQEAFLDLSVQPSHSNPEVLMDCGVDLAASCNSEPKELAGDTETAPESDEEPPEEQA
QKQDQKNREEVDSEFKEGNTATMEIDSETVQAVQSLTQENSEQDDTFQDCAETQEACRSL
QNYTHADQSPQIAATLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQISPD
QSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGG
SICGNGSSQNSCSYSNLTSSNLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCNVKSPQ
GCVVERPPSSSQQLAPCSMAANFTPPMQLAEIPETGNANIGLYERMGQSDFGAGHYPQPS
ATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGP
QAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSASL
SPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAM
NGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHGNMMYTAPG
HHGYMNTGMSKQSLNGSYMRR
NT seq 6186 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcagtgagcacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcttataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaaatcaaccaagggatctagaggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccctgaaaaacatagagaagtatctcagaagtcaaagtgatctcacg
ggcaccaccaacaacccagcctttcagcagaggctgcgactgggggccaaacgcgcagtg
aacaatgggaggttactgaaagatggaccgcagtacagggttaattatggaagcttagac
ggcaaaggggctcccaaatatcccagtgctttcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaagatggcagtgcatcgaatgcaagacctgcagtgcatgtagaatccaaggcaaa
aatgcagataatatgcttttttgtgactcctgtgatagaggattccatatggagtgctgt
gaccccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggcttattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaacccccatc
tctggtcagagccccagttcacaaaagtccagcacttccacttcttctacctctccccag
agttcttccagccagtccagtgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgatggactttctcatatctataccactcagggacagtctcggaaaaag
ggacacccaagttatgcaccacccaaacgtatgcgtcgtaaaactgaattatcttccacg
gcaaaatctaaagcccatttctttggaaaaagagatattagaagtaggtttatttctcac
tcctcctcctctagctgggggatggctagaggacgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaatcaaaataagcgtcaaacaagaaagtacagatataaat
gtggttggaaacaaggataccgttactgaagaggatttggatgtttttaagcaagcccag
gaactttcttgggagaaaatagagtgtgaaagtggagtagaagactgtggccggtaccct
tctgtaatagaatttgggaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgttaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccggaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagcccttccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagccactctctgacctgggccgtctg
tcctacctggcctattggaagagcgtcatcttagaatacctctaccaccaccacgagagg
cacatcagcatcaaggcgatcagcagagctacaggcatgtgcccacacgacatcgccacc
actctgcagcacctccacatgattgacaagagggacggcagatttgtcatcattagaaga
gaaaagttgatattgggccacatggaaaagctgaaaacctgctcccggaccaatgaactt
gatccagagagtctgaggtggaccccaattttaatttctaatgctgcagtttctgaagaa
gagcgagaagctgaaaaagaggctgagcggctaatggaacaagctagctgctgggaaaag
gaggagcaagaaatcttgtcatctagagccaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
ctgatggagctgtctaaagagagcagtgaagaggaggaggaggaggaggaggaggaagaa
gaggaggaggaggaagaggaagaagaggaggaggaggaagaagaggaagaagaaaatatt
caaagctctcctccaagattaactaaaccacaatcagttgccataaagagaaagaggcct
tttgtactaaagaagaaaagaggtcgtaaacgcaggaggatcaacagcagtgtaacaact
gagaccatttctgaaacgacagaagtactgaatgagccctttgacaactcagatgaagag
aggccaatgccacagctggaacctacctgtgagattgaagtggaggaagatggcgagaag
ccccccctgagaaaagcattccaacatcagcctgggaagaaaagacaaacaggggaagag
gaaggaaaagacaatcgttgctttaagaattccgacccttgtagaaacaatatggatgat
gatgctaataacttgaaagaaggcagtagagacaatcctgaacctctaaagtgcaaacaa
gtgtggccaaaaggaacaaagcatggtctatctaagtggagaccaaacaaagagaggaag
actggatttaaactaaacttgtacaccccaccagaaacacccatggaacctgatgaccag
gtaacagtggaagaacagaaggagactccagaggacaaaaccagccctacttccaccagg
attgaggaggaggttgaggaagctgtggaacccctgctgcctcgggatgaaaacagaagg
gaagaaacatgtgcacctataagtccaaataaatcaccaggtgaaaagccagaagacgat
ctaatcaaacctgaagaggaagaggaggaggaggaggaagaagaagaagaggaagaggag
gaggaagaagaaggaaacgtagaaaaagatcctggtggtgctaaaagtcaggaaaaagag
gaaccagaagtctgcatggacaaagaagactctgtccgtttggatgatcatgaagaggag
gaggaagaggatgaagaaccatctcacaacgagggtcatgatgcagatgatgaagatgat
agtcatatggagtctgcggaagcagagaagaaagaacacccaagagaagccttcaaagaa
gtactggaaaaccaggaggcttttttagaccttagtgtccagcctagtcattcaaaccca
gaggtcttaatggactgtggcgttgatcttgcagcttcttgtaacagtgaacctaaggag
cttgctggagacactgaaacggcacctgaatctgatgaggagcccccagaagaacaggca
cagaagcaggaccaaaagaacagggaagaagtggattctgagttcaaagagggaaataca
gcaaccatggaaatcgactctgagacagtccaggcagttcagtctttgacccaggagaac
agtgaacaggacgatacctttcaggattgtgccgagactcaagaggcctgtagaagccta
cagaactacacccatgcagaccaaagtccacaaatcgctgccacgctggatgattgccaa
cagtcagaccacagtagcccggtttcatctgtccattcccatcctggccagtcagtacgt
tctgtcaacagcccaagtgttcctgccctagaaaatagctatgcccaaattagcccagat
caaagtgccatctcagtgccatctttgcagaacatggaaaccagtccaatgatggatgtc
ccgtcagtttcagatcattcacagcaagtcgtagacagtggatttagtgacctgggaagt
attgagagcacaactgagaactacgaaaaccctagcagctatgattccactatgggtggc
agcatttgtggaaatggctcttcacagaacagctgctcttatagcaacctcacctctagc
aatctgacacagagcagctgcgctgtcacccagcagatgtccaacatcagtgggagctgc
agcatgctgcaacaaaccagcatcagttctcccccgacctgcaacgtcaagtctcctcaa
ggctgtgtggtggagcggcctccgagcagcagccagcagctggctccgtgtagcatggct
gctaacttcaccccgccgatgcagctggctgagatccctgagactggcaatgccaatatt
ggcttatatgaacggatgggtcaaagtgactttggggctgggcattacccacagccatca
gccaccttcagccttgccaaactacagcagttaactaatacacttattgatcattcattg
ccttacagccattccgctgctgtaacttcctatgcaaacagtgcctctttgtccacacca
ttaagtaacacagggcttgttcagctttcccagtctccacactctgtccctgggggaccc
caagcacaagctaccatgaccccaccccccaacctgactcctcctccaatgaatctgcca
ccgcctcttttgcaacgaaacatggctgcatcaaatattggtatctcccacagccaaaga
ctgcaaacccagattgccagcaagggccacgtctccatgagaaccaaatcggcatctctg
tcaccagccgctgccacccatcagtcgcaaatctatgggcgctcccagaccgtagccatg
cagggtcctgcacggactttaacaatgcaaagaggcatgaacatgagtgtgaacctgatg
cccgccccagcctacaatgtcaactctgtcaacatgaacatgaacactctcaatgccatg
aatgggtacagcatgtcccagccaatgatgaacagtggctaccacagcaatcatggctac
atgaatcaaacgccccaataccctatgcagatgcagatgggcatgatgggaacccagcca
tatgcccagcagccaatgcagaccccgccccatggtaacatgatgtacacggcccctggg
catcacggctacatgaacacaggcatgtccaaacaatctctcaatgggtcctacatgaga
aggtag

DBGET integrated database retrieval system