KEGG   Equus caballus (horse): 100064218Help
Entry
100064218         CDS       T01058                                 

Gene name
KAT6B
Definition
(RefSeq) histone acetyltransferase KAT6B isoform X1
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100064218 (KAT6B)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100064218 (KAT6B)
   HAT complexes
    MOZ/MORF complex
     100064218 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
1
AA seq 2063 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTGTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLLPPTPISGQSPSSQKSSTSTSSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISVKQESTDINVVGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSSV
TTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGEKPPLRKAFQHQPGKKRQTG
EEEGKDNRCFKNSDPCRNNMDDDANNLKEGSRDNPEPLKCKQVWPKGTKHGLSKWRPNKE
RKTGFKLNLYTPPETPMEPDDQVTVEEQKETPEDKTSPTSTRIEEEVEEAVEPLLPRDEN
RREETCAPISPNKSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEEEGNVEKDPGGAKSQE
KEEPEVCMDKEDSVRLDDHEEEEEEDEEPSHNEGHDADDEDDSHMESAEAEKKEHPREAF
KEVLENQEAFLDLSVQPSHSNPEVLMDCGVDLAASCNSEPKELAGDTETAPESDEEPPEE
QAQKQDQKNREEVDSEFKEGNTATMEIDSETVQAVQSLTQENSEQDDTFQDCAETQEACR
SLQNYTHADQSPQIAATLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQIS
PDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTM
GGSICGNGSSQNSCSYSNLTSSNLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCNVKS
PQGCVVERPPSSSQQLAPCSMAANFTPPMQLAEIPETGNANIGLYERMGQSDFGAGHYPQ
PSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPG
GPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSA
SLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLN
AMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHGNMMYTA
PGHHGYMNTGMSKQSLNGSYMRR
NT seq 6192 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcagtgagcacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcttataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaaatcaaccaagggatctagaggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccctgaaaaacatagagaagtatctcagaagtcaaagtgatctcacg
ggcaccaccaacaacccagcctttcagcagaggctgcgactgggggccaaacgcgcagtg
aacaatgggaggttactgaaagatggaccgcagtacagggttaattatggaagcttagac
ggcaaaggggctcccaaatatcccagtgctttcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaagatggcagtgcatcgaatgcaagacctgcagtgcatgtagaatccaaggcaaa
aatgcagataatatgcttttttgtgactcctgtgatagaggattccatatggagtgctgt
gaccccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggcttattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaacccccatc
tctggtcagagccccagttcacaaaagtccagcacttccacttcttctacctctccccag
agttcttccagccagtccagtgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgatggactttctcatatctataccactcagggacagtctcggaaaaag
ggacacccaagttatgcaccacccaaacgtatgcgtcgtaaaactgaattatcttccacg
gcaaaatctaaagcccatttctttggaaaaagagatattagaagtaggtttatttctcac
tcctcctcctctagctgggggatggctagaggacgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaatcaaaataagcgtcaaacaagaaagtacagatataaat
gtggttggaaacaaggataccgttactgaagaggatttggatgtttttaagcaagcccag
gaactttcttgggagaaaatagagtgtgaaagtggagtagaagactgtggccggtaccct
tctgtaatagaatttgggaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgttaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccggaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagcccttccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagccactctctgacctgggccgtctg
tcctacctggcctattggaagagcgtcatcttagaatacctctaccaccaccacgagagg
cacatcagcatcaaggcgatcagcagagctacaggcatgtgcccacacgacatcgccacc
actctgcagcacctccacatgattgacaagagggacggcagatttgtcatcattagaaga
gaaaagttgatattgggccacatggaaaagctgaaaacctgctcccggaccaatgaactt
gatccagagagtctgaggtggaccccaattttaatttctaatgctgcagtttctgaagaa
gagcgagaagctgaaaaagaggctgagcggctaatggaacaagctagctgctgggaaaag
gaggagcaagaaatcttgtcatctagagccaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
ctgatggagctgtctaaagagagcagtgaagaggaggaggaggaggaggaggaggaggag
gaagaagaggaggaggaggaagaggaagaagaggaggaggaggaagaagaggaagaagaa
aatattcaaagctctcctccaagattaactaaaccacaatcagttgccataaagagaaag
aggccttttgtactaaagaagaaaagaggtcgtaaacgcaggaggatcaacagcagtgta
acaactgagaccatttctgaaacgacagaagtactgaatgagccctttgacaactcagat
gaagagaggccaatgccacagctggaacctacctgtgagattgaagtggaggaagatggc
gagaagccccccctgagaaaagcattccaacatcagcctgggaagaaaagacaaacaggg
gaagaggaaggaaaagacaatcgttgctttaagaattccgacccttgtagaaacaatatg
gatgatgatgctaataacttgaaagaaggcagtagagacaatcctgaacctctaaagtgc
aaacaagtgtggccaaaaggaacaaagcatggtctatctaagtggagaccaaacaaagag
aggaagactggatttaaactaaacttgtacaccccaccagaaacacccatggaacctgat
gaccaggtaacagtggaagaacagaaggagactccagaggacaaaaccagccctacttcc
accaggattgaggaggaggttgaggaagctgtggaacccctgctgcctcgggatgaaaac
agaagggaagaaacatgtgcacctataagtccaaataaatcaccaggtgaaaagccagaa
gacgatctaatcaaacctgaagaggaagaggaggaggaggaggaagaagaagaagaggaa
gaggaggaggaagaagaaggaaacgtagaaaaagatcctggtggtgctaaaagtcaggaa
aaagaggaaccagaagtctgcatggacaaagaagactctgtccgtttggatgatcatgaa
gaggaggaggaagaggatgaagaaccatctcacaacgagggtcatgatgcagatgatgaa
gatgatagtcatatggagtctgcggaagcagagaagaaagaacacccaagagaagccttc
aaagaagtactggaaaaccaggaggcttttttagaccttagtgtccagcctagtcattca
aacccagaggtcttaatggactgtggcgttgatcttgcagcttcttgtaacagtgaacct
aaggagcttgctggagacactgaaacggcacctgaatctgatgaggagcccccagaagaa
caggcacagaagcaggaccaaaagaacagggaagaagtggattctgagttcaaagaggga
aatacagcaaccatggaaatcgactctgagacagtccaggcagttcagtctttgacccag
gagaacagtgaacaggacgatacctttcaggattgtgccgagactcaagaggcctgtaga
agcctacagaactacacccatgcagaccaaagtccacaaatcgctgccacgctggatgat
tgccaacagtcagaccacagtagcccggtttcatctgtccattcccatcctggccagtca
gtacgttctgtcaacagcccaagtgttcctgccctagaaaatagctatgcccaaattagc
ccagatcaaagtgccatctcagtgccatctttgcagaacatggaaaccagtccaatgatg
gatgtcccgtcagtttcagatcattcacagcaagtcgtagacagtggatttagtgacctg
ggaagtattgagagcacaactgagaactacgaaaaccctagcagctatgattccactatg
ggtggcagcatttgtggaaatggctcttcacagaacagctgctcttatagcaacctcacc
tctagcaatctgacacagagcagctgcgctgtcacccagcagatgtccaacatcagtggg
agctgcagcatgctgcaacaaaccagcatcagttctcccccgacctgcaacgtcaagtct
cctcaaggctgtgtggtggagcggcctccgagcagcagccagcagctggctccgtgtagc
atggctgctaacttcaccccgccgatgcagctggctgagatccctgagactggcaatgcc
aatattggcttatatgaacggatgggtcaaagtgactttggggctgggcattacccacag
ccatcagccaccttcagccttgccaaactacagcagttaactaatacacttattgatcat
tcattgccttacagccattccgctgctgtaacttcctatgcaaacagtgcctctttgtcc
acaccattaagtaacacagggcttgttcagctttcccagtctccacactctgtccctggg
ggaccccaagcacaagctaccatgaccccaccccccaacctgactcctcctccaatgaat
ctgccaccgcctcttttgcaacgaaacatggctgcatcaaatattggtatctcccacagc
caaagactgcaaacccagattgccagcaagggccacgtctccatgagaaccaaatcggca
tctctgtcaccagccgctgccacccatcagtcgcaaatctatgggcgctcccagaccgta
gccatgcagggtcctgcacggactttaacaatgcaaagaggcatgaacatgagtgtgaac
ctgatgcccgccccagcctacaatgtcaactctgtcaacatgaacatgaacactctcaat
gccatgaatgggtacagcatgtcccagccaatgatgaacagtggctaccacagcaatcat
ggctacatgaatcaaacgccccaataccctatgcagatgcagatgggcatgatgggaacc
cagccatatgcccagcagccaatgcagaccccgccccatggtaacatgatgtacacggcc
cctgggcatcacggctacatgaacacaggcatgtccaaacaatctctcaatgggtcctac
atgagaaggtag

DBGET integrated database retrieval system