KEGG   Equus caballus (horse): 100064287Help
Entry
100064287         CDS       T01058                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100064287
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP4 family
   100064287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 451 aa AA seqDB search
MVPVLLPLSLSYLGLWASGLILVLGFLKLLSLLLRRQKLARAMDSFPGAPTHWLFGHALE
LQQTGSLDKVVSWAHQFPYAHPLWYGQFLGFLNIYEPDYAKAVYSRGDPKAPDVYDFLLQ
WTGEGLLVLHGPKWFQHRKLLTPGFHYDVLKPYVAVFANSAHTMLDKWEEMAREDKSFDI
FCDVGHMALDTLMKCTFGKADTGLCHRDSSYYQAVCELTLLTQQRIDSFQYHNDFIYWLT
PHGRRFLRACQVAHDHTDRVIRERKAALQDEKEQEKIRKRRHLDFLDILLGARDEDGIKL
SDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQRCREEVREVLGDRDSFQWDDL
GKMTYLTMCIKESFRLYPPVPQVFRQLSKPVSFVDGRSLPAGSLVSLHIFALHRNSAVWP
DPEVFDPLRFSSENVARRHPFAFIPFSAGPR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgtcctgctccccttgagtctgtcctacctgggcctgtgggcttctggactg
atcttggtcttaggcttcctcaagctccttagtctgctgctgcggaggcagaagctggcc
agggctatggacagcttcccaggtgcccccacgcactggctcttcgggcacgccctcgag
ctccagcagacagggagcctggacaaggtggtgtcctgggcccaccagttcccctacgcc
cacccactctggtatgggcagttccttggcttcctgaacatctatgagcctgactatgcc
aaagctgtgtatagccgaggggaccctaaggcaccggatgtttatgacttcctccttcag
tggactggggaaggcctgctggtccttcatgggcccaaatggttccagcaccgcaagctg
ctcacgcctggcttccattatgatgtactgaagccttacgtggccgtgttcgccaactcc
gcccacaccatgctggacaagtgggaggagatggctcgtgaagataagagctttgacatc
ttctgtgatgtgggccacatggcgctggacactctcatgaagtgcacctttggcaaagca
gacactggcctgtgtcacagggacagtagctattaccaggcggtctgtgagctcactctg
ctgacacagcagcgcatcgactccttccagtaccacaacgacttcatctactggctcacc
ccccatggccgccgcttcctgcgggcctgccaggtggcccacgaccacacagaccgggtc
atcagggaacggaaggcagccctgcaggacgagaaagagcaggagaagatccggaagcgg
aggcacctggacttcctggacattctcctgggggctcgggatgaagatgggatcaagctg
tcagatgccgagctccgcgctgaggtggacacgttcatgtttgaaggccatgacaccacc
accagtggcatctcctggtttctctattgcatggccctgtaccctgagcaccagcagcgt
tgtcgggaggaggtgcgcgaggtccttggggaccgagactccttccagtgggatgatctg
ggcaagatgacctacttgaccatgtgcatcaaggagagcttccgcctctacccgcccgtg
ccccaggtgttccgccagctcagcaagcccgtcagcttcgtggatggccgctccctaccc
gcaggcagcctggtctctctgcacatcttcgccctccataggaacagcgcagtgtggccc
gaccctgaggtctttgaccccctgcgcttttcatctgagaacgtggccaggcgccatccc
tttgccttcatacccttctccgctgggcccaggtaa

DBGET integrated database retrieval system