KEGG   Equus caballus (horse): 100064347Help
Entry
100064347         CDS       T01058                                 

Gene name
EEA1
Definition
(RefSeq) early endosome antigen 1
  KO
K12478  
early endosome antigen 1
Organism
ecb  Equus caballus (horse)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100064347 (EEA1)
   04145 Phagosome
    100064347 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100064347 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 1364 aa AA seqDB search
MKSLGSADELFKHYQAVHDAGNDSGHGGEALALKRDDITLLRQEVQDLQASLKEEKWYSE
ELKKELEKYQGLQQQESKPDGLVADSSAELQSLEQKLEEAQTENFNIKQMKDLFEQKAAQ
LATEIADIKSKYDEEKSLREAADQKVTHLTEELNKAAAVIQDLKTELLQRPGIEDVAVLK
KELVQVQTLMDNMTLERERESEKLKDECKKLQAESANSEATISQLRSELAKGPQEVAVYV
QALQKLKSLVNELTQKNQNLTEKLLKKEVDYTQLEEKHNEECVSKKNIQANLHQKDLDCQ
QLQSRLSASESSLQRIQAELGEKGEATQKLKEELSEAETKYQHLKAEFKQLQQQREEKEQ
HGLQLQSEINQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEE
QLKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQN
LEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQ
SESHKQAQENLHDQVQEQKAHLRAAQDRVLSLEASVNELSSQLNESKEKVSQLDIQVKAK
TELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITAQLDQVTAKLQDKQEHCIQL
ESNLKEYKEKHLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQERQLNADLELRA
TELSKQLEVEKEIVSSTKLDLQKKSEAFENTKQMLTKQEEEKIMLKQEIENLSQDAKMQH
KELNNKIQTTVTELQKVKMEKETLMTELCAAKEKLSKVSDSLKNSKSEFEKENQKGKAAI
LDLEKTCKELKHQLQVQTESTLKEQNELKKSLEKEKETSHQLKLELSSMQGQVIQAQNAL
KQKEKEEQQLQGNMNELKQLTEQKKKQIEALHGEIKIVTSQKTELENKLQQQSTQAAQEL
AAEKEKISVLQNTYEKSQENLKQLQSDFYGKESELLATRQDLKSVEEKLSLAQEDLISNR
NQIGNQNKLIQELKTAKTTLEQDSAKKEQQLKEQCKALQDIQKEKALKEKELVNEKSKLA
EIEEIKCRQEKDIAKLSEELKSHKQESIKEVTNLKDAKQLLIQQKLELQGKVDSLKGALE
QEKRNQQMLKEQMKKEEDELKKEFTEKEAKLHSEIKEKEAGMKKYEENETKLSMQITALN
ENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIE
KLQTRVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSV
TVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcttggatctgctgatgaacttttcaaacactatcaggcagttcacgatgct
ggtaatgattcaggtcacggaggagaggctctcgctttgaagcgagatgatataacacta
ctcagacaagaggtccaagacctgcaggcttcacttaaggaagaaaaatggtattcagag
gaattaaagaaagaattagaaaaatatcaagggctgcagcagcaagagtctaaacctgat
ggattggtggctgattcatcagcagaactacagtctttggaacaaaaattagaagaagcc
caaacagaaaattttaatattaagcaaatgaaagacttatttgaacagaaagcagcccaa
cttgctactgaaattgcggatataaagtcaaaatatgatgaagaaaagagtcttcgagaa
gctgctgatcaaaaggtgacacatctgacagaagaattaaacaaagcagcagctgtaatt
caagatctgaagaccgaactgcttcagagacctggtatagaagatgttgctgtgctaaag
aaagaactggtccaagttcaaacactgatggacaacatgaccttggaacgagagagagaa
tctgaaaaactcaaagatgagtgcaaaaagttacaagcagagtctgctaactccgaggct
acaataagccagctaaggagtgaacttgccaaaggccctcaggaagttgctgtatatgtg
caggcactacaaaaacttaaaagtttagttaatgaattaacacaaaaaaatcagaacttg
actgaaaaactgctgaagaaagaagtggactatactcagttagaggagaaacataatgaa
gaatgtgtgagtaaaaagaatatacaagcaaaccttcatcaaaaagacctagattgtcaa
cagcttcagtcaagattatctgcatctgaaagctccctgcagagaatacaggcagaacta
ggtgaaaagggagaagctactcaaaagctcaaagaagaattatcagaagcagagaccaag
taccagcatcttaaggcagagtttaaacagctacaacaacagagagaagaaaaagagcag
catgggttacaactccaaagtgagattaatcaattacatagcaaacttctggagacagag
cgccaactaggggaagctcatggtaggctaaaggaacagagacagctttcaagtgaaaag
ctgatggataaagaacagcaggtggctgatctgcaactcaaactttctcgtttagaagaa
cagttgaaggaaaaagtaacaaattccacagaattgcagcatcaactagataaaacaaag
cagcagcatcaagaacaacaagctcttcaacaaagcactacagcaaaacttcgagaggct
cagaatgatttggaacaagtactacgtcaaattggagataaggaccaaaagatccagaac
cttgaagccttattacagaagagtaaagaaaatatttccttattagaaaaggaaagagaa
gatctttatgcaaaaattcaggctggtgaaggagagactgctgttcttaaccagttacaa
gaaaaaaaccatacattacaggaacaagtaactcaactaacagagaagctgaagaatcag
tcagaaagtcataaacaagcccaggagaatttgcatgaccaggtgcaagagcagaaggca
catcttagagctgcacaagaccgtgtgctttccctggaagccagtgtcaatgaattaagt
agtcaattaaatgaaagcaaagagaaggtctcccagcttgacatacaggttaaagccaaa
actgaattattgctctcagcagaagcagcaaaaactgctcaaagagcagatcttcaaaat
catttggacacagcccaaaatgcgttacaagataaacagcaggagttaaataagatcact
gctcagttggatcaggtcactgcaaagttgcaggataagcaagaacattgcattcagctg
gaaagtaatcttaaagaatataaagagaaacacctctctttagaacagaaaactgaagaa
ttagaaggtcaaattaagaaactagaagctgattctcttgaagttaaagcaagcaaggaa
caagctctacaggatctacagcaggagagacagctgaacgcagatttagagcttagagcc
acagaactgagcaaacaacttgaagtggagaaagaaatagtatccagtacaaagttggat
ctacagaaaaaatctgaagcctttgaaaatactaagcaaatgcttaccaagcaagaggaa
gaaaaaataatgcttaaacaagaaattgaaaatttaagtcaagatgcaaaaatgcagcac
aaggaattaaacaacaaaattcaaacaacagtaacagaactacaaaaagtgaagatggag
aaagagactctaatgacagagctttgtgcagcaaaagaaaaattatcaaaagtttctgat
tctttgaagaactccaaaagtgaatttgaaaaggaaaatcagaaaggaaaagctgctata
ttagatttggaaaaaacttgcaaagaattaaagcatcaacttcaagtacagacagaaagc
acacttaaggaacagaatgaactgaaaaagtcacttgaaaaagagaaggagacctctcat
cagttgaagttggaactcagttcaatgcagggacaagtcatacaagcccagaatgcttta
aaacaaaaggaaaaagaagagcaacaactgcaggggaacatgaatgagctaaagcagctg
actgaacagaagaaaaagcaaattgaagccctccacggggaaattaaaattgttacttca
cagaagacagaacttgagaataaactgcaacagcagtcaacacaggcggcacaggaactc
gcagcagagaaagagaaaatatcagtgttacaaaacacctatgaaaaaagtcaggaaaat
ctaaaacagcttcagtctgatttctatgggaaggaatctgagcttcttgccacaaggcaa
gatcttaagtctgtagaggagaagctttctctagcacaggaggacttgatttcaaacaga
aatcaaattggaaaccaaaataaattgattcaagaactgaagactgccaagactactttg
gagcaggattcagcaaagaaagaacagcaattaaaggagcagtgtaaagcactacaggat
attcaaaaagaaaaggcactgaaagagaaagaactagtaaatgaaaaatctaaattggca
gagatagaggaaattaagtgtagacaagaaaaagacattgctaaattgagtgaagaactc
aagtcccacaagcaggagagcataaaggaggtaacaaatctcaaggatgccaaacagctt
ttgattcagcagaaattagagcttcaagggaaagtagattccctgaagggagcccttgaa
caggagaagagaaaccagcaaatgctgaaagagcagatgaaaaaggaagaagatgagctg
aagaaagagtttactgagaaggaagctaaactgcattctgaaataaaagaaaaggaagcc
ggaatgaagaagtatgaagaaaatgaaactaaacttagcatgcagattacagcattaaat
gaaaacctgggcactgtaaagaaggagtggcagtccagtcaacggagagttagtgagctc
gagaagcagacggatgacttacggggtgaaattgcagtattggaagcaacggttcagaat
aatcaagatgaaaggagggcactactagaaaggtgtcttaaaggagaaggtgaaatagaa
aagcttcaaaccagagtgctagaattgcagagaaagctggacaacacaactgcagcagtg
caggagctgggccgagaaaatcagtcccttcagatcaaacatacgcaagcgttgaataga
aagtgggcggaagacaatgaagtacaaaactgtatggcctgtgggaaaggcttttcagta
acagtaagacggcatcactgcagacaatgtgggaatatcttctgtgctgaatgttcagcc
aaaaatgccttaactccttcttccaagaagcctgttcgtgtctgtgatgcatgtttcaat
gacttgcagggatag

DBGET integrated database retrieval system