KEGG   Equus caballus (horse): 100064527Help
Entry
100064527         CDS       T01058                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100064527 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
31
AA seq 288 aa AA seqDB search
MPGARSGGSGSGGDGNHSGGYSGDASRAVTVWEVFSLLGKLLGTVAALKVVLYLLRVCLA
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATIS
APHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGPTGKVVGIDHIKELVDDSI
NNVRKDDPMLLSSGRVQLVVGDGRMGYPEEAPYDAIHVGAAAPVVPQALLDQLKPGGRLI
LPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcagtggcggcagcggtagcggcggcgacggcaatcacagcggcggc
tacagcggggacgcgagcagggcggtgaccgtgtgggaggtgttctcactcttggggaag
ctgttgggcaccgtcgccgcgctgaaggtagtcctgtacctgctccgggtgtgcttagcg
atggcctggaaatccggcggcgccagccactcggagctaatccacaacctccgcaaaaat
ggaatcatcaagacagataaagtctttgaagtcatgctggccacagaccgctcccactat
gcaaaatgtaacccttatatggattctccacaatcaataggtttccaggccacaatcagt
gctccacacatgcatgcatatgcactagaacttctatttgatcagttgcatgaaggagct
aaagctcttgatgtaggatctggaagtggaatccttactgcgtgttttgcacgtatggtt
ggacctactggaaaagtcgtaggaattgaccacattaaagagctggtagacgactcaata
aataacgtcagaaaggacgatccgatgcttctgtcttcagggagagtgcagctggttgtg
ggagatggaagaatgggatatcctgaagaagccccttatgatgctattcatgtaggagcc
gcagccccagttgtgccccaggcactgttagaccagttaaagccaggtggaagattgata
ttgccagttggtcctgcaggtggaaaccagatgttggagcagtacgacaagctacaggat
ggcagtatcaaaatgaaacctctgatgggagtgatatacgtgcctttaacagataaggaa
aagcagtggtccagggacgaactgtaa

DBGET integrated database retrieval system