KEGG   Equus caballus (horse): 100064555Help
Entry
100064555         CDS       T01058                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecb00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 540 aa AA seqDB search
MQGAWVLLLLLGLRLRLSLGVIPVEEEDPAFWNRQAAQALDTAKKLQPIQTAAKNLIIFL
GDGMGVPTVTATRILKAQMDGKLGPETPLAMDHFPYLALSKTYNVDRQVPDSAGTATAYL
CGVKANYQTIGVSAAARYNQCNTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGTY
AHTVNRNWYSDADMPDEALKEGCQDIATQLISNMDIDVILGGGRKYMFPKGTPDPEYPND
ASQNGTRVDQRNLVQEWLAKYQGAQYVWNRTALIQASQDPSVTHLMGLFEPADMKYEAQR
DLTLDPSLTEMTEAALRVLSRNPSGFYLFVEGGRIDHGHHAGTAYLALTEATMFDDAIDK
ASQLTSEEDTLILVTADHSHVFSFGGYTLRGSSILGLAPSKASDGKAYTSILYGNGPGFA
LSQGSRPDVNESQSMDPAYKQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQTFVAH
VMAFAACLEPYTACDLSPPATSTDSTNPGLTDAALPRPAAGSLSLQLLVGALLLLLSATH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcctgggtgctgttgctgctgctgggcctgaggttacggctctcccttggg
gtcatcccagttgaggaggaggacccggccttctggaaccgccaggcagcccaagccctg
gacaccgctaagaagctgcagcccatccagacggccgccaagaacctcattatcttcttg
ggggacgggatgggggtgcccacggtgacagccactcggatactgaaggcacagatggat
ggcaagctgggacccgagacgcccctggccatggaccacttcccctacctggctctgtcc
aagacatacaacgtggacagacaagtgccggacagcgcaggcacagccacggcctacctg
tgcggggtcaaggccaactaccagaccatcggtgtgagtgcggccgcccgctataaccag
tgcaacacgacgcgtggcaatgaggtcacctccgtgatgaatcgagccaagaaagcaggg
aagtcagtgggggtggtgaccaccaccagggtacagcatgcgtcgccagccggcacctac
gcgcacacggtgaaccgcaactggtactcggacgctgacatgcctgacgaggcgctgaag
gagggctgccaggacatcgccacgcagctcatctccaacatggacattgatgtgatcctg
ggcggaggccgcaagtacatgtttcccaaggggaccccagaccctgagtatccgaatgat
gccagccagaacggaaccagggtggaccagcggaacctggtgcaggagtggctggccaag
taccagggtgcccagtatgtgtggaaccgcacggcgctcatccaggcgtcccaggacccc
tctgtgacacacctcatgggcctctttgagccagcggacatgaaatatgaggcccagcga
gacctcaccctggacccatccctgacggagatgaccgaggcggccctgcgtgtgctgagc
aggaaccccagtggcttctacctcttcgtggaggggggccgcatcgaccatggtcaccat
gctggaaccgcttacctggcactgaccgaggccaccatgttcgatgatgccattgacaaa
gccagccaactcacaagtgaggaggacacactgatccttgtcaccgctgaccactctcac
gtcttctcttttggtggctacacactgcgtggcagctccattttagggctggcccccagc
aaggcctccgatggcaaggcctacacctccatcctgtatggcaatggcccaggcttcgca
ctcagccagggctcccggcctgacgtcaacgagagccagagcatggaccccgcgtacaag
cagcaggcggccgtgcccctgtcgtcggagacccacggcggcgaggacgtggcggtgttc
gcgcgcggcccgcaggcgcacctggtgcacggcgtgcaggagcagaccttcgtggcgcac
gtcatggccttcgccgcctgcctcgagccctacacggcctgcgacctgtcgccccccgcc
acatccaccgacagtacaaatcccgggctcactgatgctgcgctccccaggccggctgct
ggctcactatcgctgcagcttctggttggagcgctgctactgctgctgtccgccacccac
tga

DBGET integrated database retrieval system