KEGG   Equus caballus (horse): 100064886Help
Entry
100064886         CDS       T01058                                 

Gene name
PCSK1
Definition
proprotein convertase subtilisin/kexin type 1
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100064886 (PCSK1)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S8: subtilisin family
   100064886 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 754 aa AA seqDB search
MERRAWTLQCTAFALFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSILRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYDN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVPEKKECVVKDNDFEPRALT
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDSGEEQPTQENLTTNPLASKSPSGSSSVGGRRAELA
EGAPSEAMLRLLQSAFSKNPAAQQSPKKSPSAKLNIPYENFYQALEKLNKPSQLKDSEDS
LYNDYVDVFYNTKPYKHRDDRLLQALVDILREEN
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgtactgctttcgctctcttttgcgcttggtgt
gcattgaacagtgtaaaagcaaagaggcagtttgtgaatgaatgggcggcggaaatcccc
gggggaccggaggcagcctcggccatagccgaggagctgggctatgaccttttgggtcag
ataggatcacttgaaaatcactatttattcaaacataaaaaccatccccgaagatctcga
agaagtgcctttcatatcaccaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcaattctaagagactcagcactaaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagatactaggatgaccgcagcc
ctgcccaaactggacctccatgtgatacctgtttggcaaaaaggcatcacaggcaaagga
gttgttatcactgtactggatgatggcctggagtggaatcacacagacatctatgacaat
tatgatccagaggctagctatgattttaacgataatgaccatgatccatttcccagatat
gatcccacaaatgagaacaaacatgggaccagatgcgcaggagaaattgccatgcaagca
aataatcacaagtgcggggttggagttgcatacaattccaaagtcggaggcataagaatg
ctggatggcattgtgactgatgctattgaagccagttcaattggattcaatcctggacat
gtggatatttacagtgccagttggggcccaaacgatgatgggaaaactgtggaagggccc
ggccgattagcccagaaggcttttgaatatggtgtcaaacaggggagacaaggaaagggt
tccatcttcgtctgggcttccgggaatggggggcgtcagggagataactgtgactgtgat
gggtacacggacagcatctacaccatctccatcagcagtgcctcgcagcaaggcctgtcc
ccctggtatgctgagaagtgctcctccacgctggccacctcctacagcagcggcgattac
accgaccagagaatcacgagcgccgacctgcacaatgactgcacagagacccacacgggc
acctcggcctcagcacccctggctgctggcatcttcgctctggccctggaagcaaatcca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccactg
gccaataaccccggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttgggttgctaaatgccaaagctctggtggatttagctgatcccaggacctggagcagt
gtgcctgagaagaaagagtgtgttgtgaaggacaatgactttgagcccagagccttgaca
gctaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgct
atcaagtccttggaacatgtgcaatttgaagcaacaattgaatattcccgcagaggagat
cttcatgtcacactcacttctgctgctggaaccagcactgtactgttggctgaaagagag
cgggatacatctcctaatggctttaagaactgggacttcatgtctgttcacacgtgggga
gaaaatcccatcggtacctggactttgcgaattacagacatgtctggaagaatgcaaaac
gaaggaagaatcgtgaactggaagctgattttgcatgggacctcttctcagccagaacac
atgaaacagcctcgtgtatatacatcctacaacaccgttcagaatgacagaagaggggtg
gagaagatggtggattcgggcgaggagcagcccacacaagagaacctgaccacgaacccc
ctggcgtcaaaaagccccagcggcagcagcagcgttgggggcagaagggccgagctagcc
gagggagccccgtccgaggccatgctgcgactcttacagagcgctttcagcaaaaaccca
gccgcacagcaatcaccaaagaagtcgccaagtgcaaagctcaacatcccttacgaaaat
ttctaccaagccctggaaaagctgaacaaaccttcccagcttaaagactctgaggacagt
ctgtataacgactatgtggatgttttctacaacacgaaaccttacaagcacagagatgac
cggctgctgcaagctctggtcgacattctgagggaggaaaattaa

DBGET integrated database retrieval system