KEGG   Equus caballus (horse): 100064903Help
Entry
100064903         CDS       T01058                                 

Gene name
PRKX
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PRKX
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100064903 (PRKX)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100064903 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
X
AA seq 356 aa AA seqDB search
MEAPGLAKAAAADPSPRESPRETPDGAKLPSPGAPSPEPPAYRLQDFDTLATVGTGTFGR
VQLVKEKKAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLVKLFWTYHDERFL
YMLMEFVPGGELFSYLRNRGRFASNTGLFYSAEIVCAIEYLHSKEIVYRDLKPENILLDR
DGHIKLTDFGFAKKLVDKTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFP
PFFDDNPFGIYQKILAGKIDFPRHLDFSVKDLVRKLLVVDRTRRLGNMKNGADDVKRHRW
FRTVDWEAVPQRKLKPPIVPKVCGEGDTSNFEAYPENDWNTAPPVSPKDLEVFKNF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgggctggctaaggcggccgcggcggaccccagcccccgagagagccca
agggagacccccgacggggcgaagttacccagccccggggcaccctctccggagcctccc
gcttaccgcctgcaggacttcgacacgctggccaccgtgggcacggggaccttcgggcgc
gtgcagctggtcaaggagaagaaagccaagcatttcttcgcactgaaggtcatgagcatc
cctgacgtcatccgcctgaagcaggagcagcatgtgcacaacgagaagtcggtgctgaag
gaagtcagccatccgttcctggtcaagctgttctggacgtaccatgatgagcgcttcctc
tacatgctgatggagtttgtgccgggcggcgagctcttcagctacctgcggaaccggggg
cgctttgccagcaacactgggctcttttactccgcggagatcgtctgtgccattgagtac
ctgcactcaaaggagatcgtctacagggacttgaagccagaaaacatactgctggacagg
gatggtcacatcaaactcactgactttgggttcgctaagaaactggtagacaagacgtgg
accctttgtggaacacccgagtacctggcccccgaagtcatccagagcaaaggccacggg
agagccgtggactggtgggcgctcggcatcctgatatttgagatgctctcggggtttcct
ccattttttgatgacaacccatttggcatttatcaaaaaattcttgcaggcaaaatcgat
ttcccgagacatttggatttcagtgtaaaagacctcgttaggaagctgcttgttgttgac
agaacaagacgactgggaaacatgaagaatggagcagatgatgtgaagcgacatcggtgg
ttccgaactgtggactgggaggctgtgccccaaaggaaactgaagccccccatcgtgccc
aaagtatgtggtgagggcgatacctccaacttcgaagcttatcccgagaatgactggaac
acagctcctccggtgtcgccgaaagatttggaagtcttcaagaatttctga

DBGET integrated database retrieval system