KEGG   Equus caballus (horse): 100064910Help
Entry
100064910         CDS       T01058                                 

Gene name
KAT8, MYST1
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100064910 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 459 aa AA seqDB search
MAAQAAAAAVAAATSGISGESEPGPGENAAVEGTAPSSPGRVSPPTPARGEPEVTVEIGE
TYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAV
QKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYV
DKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKE
IYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIV
GYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKL
SYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTP
KLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacaggcagctgctgcggcggttgcggcggcgacttcagggatctcgggggag
agcgagcccgggcccggggagaatgcggcagtcgagggaactgccccgtcgtccccgggc
cgcgtctctccgccgacgccggcgcgcggcgagccggaagtcaccgtggagatcggagaa
acgtacctgtgccggcggccggatagcacctggcattctgctgaagtgatccagtctcga
gtgaatgatcaggagggccgagaggaattctatgtacattacgtgggctttaaccggcga
ctggacgaatgggtagacaagaaccggctggcactgaccaagacagtcaaggatgctgtg
cagaagaactcagagaagtacctgagtgagctggctgagcagcctgagcgcaagatcact
cgcaaccagaagcgcaagcatgatgagatcaaccacgtgcagaagacctatgcagagatg
gaccccacgacagcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtg
gacaagatccatattggaaactatgaaatcgatgcctggtacttctcgccattccctgaa
gactatgggaagcagcccaagctctggctctgcgagtactgcctcaagtatatgaaatat
gagaagagctaccgcttccacttgggccagtgtcagtggcggcagcccccaggaaaggaa
atctatcgcaagagcaacatctctgtgtacgaggtggatggcaaagaccacaagatttac
tgtcagaacctgtgtctgctggctaagcttttcctggaccacaagacattgtacttcgac
gtggaacccttcgtcttttacatcttgactgaggtggacaggcagggagcacacatcgtc
ggctacttctctaaggagaaggagtctccagatggtaacaacgtggcctgcatcctgacc
ctgcccccctaccagcgccgtggctacggaaagttcctcattgctttcagttatgagcta
tccaagctagagagcacagtaggctcccccgagaagccactgtctgacttgggcaagctc
agctaccgcagctactggtcttgggtcctgctggagatcctgcgagacttccggggtaca
ctgtctatcaaggaccttagccagatgaccagtatcacccagaatgacatcatcagcacc
ctacagtccctcaacatggtcaagtactggaagggccagcatgtgatctgtgtcacaccc
aagctggtagaggaacacctcaaaagtgcccaatataagaaaccacccataacagtggac
tctgtctgcctcaagtgggcaccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system