KEGG   Equus caballus (horse): 100064919Help
Entry
100064919         CDS       T01058                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ecb  Equus caballus (horse)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100064919
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100064919
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100064919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 304 aa AA seqDB search
MAQYHNDCKKNDEVEFVRTGYGKDMIKLLHIQRDGKYHSIKEVAASVQLTLSSKKEYLHG
DNSDIIPTDTIKNTVHVLAKFKGIKSIEAFAMSICEHFLSSFNHVIRAQVYMEEVSWKRF
EKNGVKHVHAFIHTPTGTHFCEVEQMKNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTT
LPEVKDRCFATQVYCKWRYHQCRDVDFDATWDTVRDIVLEKFAGPYDKGKYSPSVQKTLY
DIQVLSLSRVPEIEDMEISLPNIHYFNIDMSKMGLINKDEVLLPLDHPYGRITGTVKRKL
TSRL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcataatgactgtaaaaagaatgatgaggtggagtttgtccgaactggc
tacgggaaggatatgataaaacttctccatattcagcgagatggaaaatatcacagcatt
aaagaggtggcagcttcagtgcaacttactctgagctccaaaaaagagtatctccatggg
gataactcagacatcatccctacagacaccatcaagaacacagttcacgtcttggcaaag
ttcaaggggatcaaaagcatagaagcctttgctatgagtatctgtgagcacttcctttct
tcttttaaccatgtcatccgagctcaagtctacatggaagaagtctcttggaagcgtttt
gaaaagaatggagttaagcatgtccacgcatttattcacacccccacgggaacgcacttc
tgtgaggttgaacagatgaagaatggacctccagtcattcattctggaatcaaagacctc
aaggtcttgaaaacgacccagtctggatttgaagggttcatcaaggaccagttcaccact
ctccctgaggtgaaggaccggtgctttgccacccaagtgtactgcaagtggcgctaccac
cagtgcagagacgtggactttgacgctacctgggacactgttcgggacattgtcctagag
aaatttgctggaccctatgacaaaggcaagtactcaccctccgtccagaagaccctctat
gacatccaggtgctctccctgagccgggttcctgagatagaagatatggaaatcagcctg
ccaaacattcactactttaacatagacatgtccaaaatgggactgatcaacaaggatgag
gtcttgctaccattagatcatccatatggcagaattaccggtacggtcaagaggaagctg
acttcgaggctgtga

DBGET integrated database retrieval system