KEGG   Equus caballus (horse): 100064995Help
Entry
100064995         CDS       T01058                                 

Gene name
NUP205
Definition
(RefSeq) nuclear pore complex protein Nup205 isoform X1
  KO
K14310  nuclear pore complex protein Nup205
Organism
ecb  Equus caballus (horse)
Pathway
ecb03013  RNA transport
Module
ecb_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100064995 (NUP205)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100064995 (NUP205)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100064995 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 100064995
NCBI-ProteinID: XP_023495529
Ensembl: ENSECAG00000009751
Position
4
AA seq 2020 aa AA seqDB search
MGPKQGKQSRELDDLFLSASLWGPYKDIWQTVGNALWRRQPEAVHLLDMILKKHKPDFIS
LFKNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELL
LAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELVSMTTR
FTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESL
FAWACQSPLGKDDTLLLIGHLERVTVEANGSLDSVNLALLMALLYCFDTSFIEQSTEERD
DMIHQLPLLTEKQYIATIHSRLQDSQPWKLPGLQAIVRLAWALALRGISQLPDVTALAEF
TEADEAMAELAIADNVFLFLTESVVVSENFYQEEFYIRRIHNLITDFLALMPMKVKQLRN
RADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFNLELALEYWCPSEPLQT
STILGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQCAHYCFS
LLKVNGSSHVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQK
EQDGLIAFLQLTSTIISWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAA
FGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLIS
TLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKL
LRDYEPQLEDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDT
YAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKK
ADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSVSQKLMAGFV
ECLDSEDAEEFVRLEEGSELEKKLAGIRHETRIHILNLLITSLERNPPNLALYLLGFELK
KPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCA
CSDTSGPTMRYLRTSQDFLFSQLQHLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQ
RSHTQRLLHLLLDDMPVKPYSDGEGGLEDENRSISGFLHFDTATKVRRKILSILDSIDFS
QEIPEPLQLDFFDRVQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQR
PLLMEEISTILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQSEDRQLIIR
DILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVLGPGEAPYAFMLD
SSFTSPPPAENPLVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIA
QRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIG
RMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDHTLQSLLTPQPPLLKALYT
YESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGMFGMRDPPVFIPSP
VDRYRQILLPALRLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQE
LALLTGIISKAGLPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFK
FQDDNVEGDKVSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETINR
DGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRRSVNKLQNVEQLPPDEIK
ELCQSVMPAGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETCLFILWRHLEYYL
LHCTPTDSQDSLFASRALFKSRRLQDSFASETNLDFRSGLTVVSQHDIDQLQADAINAFG
ESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6063 nt NT seq  +upstreamnt  +downstreamnt
atgggaccaaagcaggggaagcaaagcagggagctggacgatctctttctctctgctagt
ctctggggtccttacaaagacatctggcaaacagtgggcaacgctctttggagaagacaa
cctgaagctgtccatcttcttgatatgattttgaagaaacacaaacctgacttcatctca
ttgttcaaaaacccaccaaaaaatgttcaacaacatgagaaggttcagaaagccagtaca
gaaggagtcgccatccagggtcagcaggggacccggcttcttcccgaacagctcattaaa
gaggcctttatcctcagtgacctttttgatattggagaattggcagctgttgagcttctc
ctcgccggagagcaccaacagccgcattttcctggcctcactagaggattagtagctgtt
cttttatactgggatggaaaacgatgcattgcaaattccctgaaagccttgatacagtct
agacgaggaaagacatggacccttgaactcagtccagagctagtttccatgacaacacgc
tttacagatgagctgatggagcaaggattgacttacaaagtccttactctggtgtcacag
attgatgtgaacaatgagtttgaaaaactgcagcgcgagagaggcttgggcagtgaaaaa
catcgcaaagaggtttctgatctcatcaaggagtgcaggcagtctctagcagaaagcctt
tttgcctgggcttgccagtcacctttaggcaaagatgacactcttctccttattggacat
ttggagagagtgacagttgaggctaatggctcattggactcagtgaatctggctcttctt
atggcacttctctactgctttgataccagttttatagaacaaagcacagaggaacgtgat
gatatgattcatcaacttccgctgttgacggagaaacaatacattgcaacaattcactct
cgccttcaagactcacagccttggaaactgcctgggctgcaagccattgttagacttgcc
tgggcactggcattgaggggaatatctcagctacctgatgtgacagcactggctgaattc
acagaagcagatgaagcaatggcagagctcgcaattgctgacaatgtttttctgttcctc
actgaatctgtggtggtatcagaaaacttctatcaggaggaattttatattcgtagaatc
cataatctcatcacagatttccttgcgcttatgccaatgaaggtgaagcagttgaggaat
cgggcagatgaagatgctcgaatgattcacatgagtatgcagatgggtaatgaacccccc
atttcacttagaagggatctggaacacttaatgctcttgattggtgagctatataaaaag
aacccttttaatttggagcttgctctagaatattggtgtccctcagagcctcttcagact
tccactatcctgggctcttaccttggggtggctcatcagcgaccccctcaacgccaggtt
gtcttgtcaaaatttgttaggcaaatgggtgatctgttgcctccaactatttatattcct
tatttgaaaatgctccagggattggccagtgggccccagtgtgcccactactgttttagc
ctgctcaaagtcaatggtagtagtcatgttgaaaatattcagggagcaggtggaagtcct
gtttcttgggaacatttctttcactccttaatgctttaccatgaacacctccggaaggac
cttccgagtgcagatagtgtccagtaccgtcaccttccttcacgtggcatcacccagaag
gagcaagatggattgattgcttttttacagctcacatctaccatcattagttggagtgaa
aatgctcgtctggcactctgtgagcatcctcagtggacgcctgttgtggtgatcctggga
ctcctgcaatgcagtattccccctgttctaaaagctgaactactgaagacacttgcagct
tttggaaaatctcctgaaattgctgcttccctctggcagtcattggaatacactcagata
cttcagaccgtaagggttccaagccagaggcaagctattggtattgaggttgaactaaat
gaaatagaatcgcggtgtgaggaatacccgttgactcgggccttttgccagcttattagt
accctggtggagagctcatttccttctaatctgggcgctggactgcggccccctggcttt
gacccttatttgcagttccttagagattctgtgtttctccgattccgcacaagagcttac
cggagagcagctgaaaagtgggaagttgctgaggttgttttggaggtgttttataaattg
ctcagagattatgagcctcaactcgaagattttgtagaccagtttgtggagctacaagga
gaagaaatcatagcctataagccaccaggatttagtctgatgtatcatcttctgaatgag
tcaccaatgttggagcttgctcttagtttactggaagaaggcgtgaagcagcttgatacc
tatgcccctttccctgggaagaaacacttggagaaagcagtacagcattgccttgcactt
ctcaatcttactctacaaaaggaaaatctgtttatggatcttctgagagagagtcagctg
gctctcatagtctctcctttagaacagctgctgcagggaatcaatcccagaactaagaag
gctgataatgtggtgaatattgccagatatctctatcatggcaatactaatccagaactg
gcttttgaaagtgccaagatcctctgctgtatctcttgcaactccaacattcagataaaa
ttggttggagatttcacacatgaccagagtgtaagtcagaagctgatggctgggtttgtg
gagtgcttggatagtgaagatgcagaagaatttgtacgtctggaagagggatcagaactt
gaaaagaaattagctggaatccgtcatgaaacaagaatccacatcttgaatcttcttatc
acctctctggaacgcaatccaccaaatcttgctctctatctgttgggctttgaattgaag
aaacctgtcagtaccacaaacctacaagatccaggagtgttaggttgccctcggacatgc
cttcatgccatcttaaacatcttggagaaaggaactgaagggagaacaggcccggtggca
gtgagagaatctcctcaactcgctgagctgtgttaccaggtgatatatcagttatgtgca
tgctctgatacatctggtcctactatgagatacttgagaaccagccaggatttcttattt
tctcagttgcagcatttaccattttctaacaaagaatatgaaatatctatgctgaaccaa
atgtcatggctgatgaagactgcttcaatagaactgagggtaacttctctgaatcgtcaa
cggtcacatacccagaggctcctgcaccttttattggatgacatgccagtaaaaccatac
tcagatggtgaaggaggactagaagatgaaaataggtccatctctgggttccttcacttt
gacactgccacgaaagtacgtcgaaaaattctaagcattctcgactcgattgacttcagt
caggagatccctgagcctttgcagttggatttctttgatcgggtccagattgaacaagtt
attgccaactgtgaacacaagaatttacggggacagacagtctgcaatgtcaagcttctt
catagggttcttgtagctgaagtcaatgctcttcagggtatggcagccataggacagaga
cctctactaatggaggaaatcagcacaatacttcagtatgtggtaggaagaaacaaactg
ctgcagtgtcttcatgcaaagcggcatgcgctggagtcatggaggcagctggtggaaatt
atactgacagcttgtccccaggacctcattcagtcagaggatcgacaactgattattcgt
gatattttacaagatgtgcatgataagatactggatgacgaagcagcacaggagttaatg
ccagtggtagcaggtgctgtgttcaccctgacggctcacctaagccaagccgttcgcacg
gaacagaagcaaccattggtcctgggacccggagaggccccttacgcttttatgcttgat
agctctttcacctcacctcctccagcagagaacccactggtgggttttgcttctattgga
gattcttcacttcacatcatattgaagaaactgttagacttcattttgaagacaggtggc
ggattccagcgagtgaggacacacctgtatggctctctgctttattacttacagatcgcc
cagagacctgatgaaccagacaccttagaagcagccaagaaaaccatgtgggaaaggctg
acagcccctgaagatgtatttagtaaattacagcgagaaaacatagccatcattgagagc
tacggtgctgctctcatggaagtggtctgtcgagacgcttgtgatggtcatgagattgga
aggatgctggcactggctctccttgatcggattgtctctgtagataagcagcagcagtgg
cttttgtatctttctaacagtggctatttgaaggtgcttgtggacagcttggtagaagat
gaccatactttgcagagcttactcactccacaacctccccttttaaaagccctttatact
tacgaatctaaaatggcatttctcacaagagtggctaagatacagcagggcgctttagag
ctgctgaggtctggggtcattgtgagactggcacaatgccaagtctatgacatgcgcccg
gaaatggacccgcagggcatgtttggcatgagagatcccccagtgttcatcccttctccg
gtggaccggtaccgtcaaattctccttccagctctccgcttgtgtcaagttatcctcaca
tctagtatggcccagcacttgcaggcagcagggcaggtgctgcagtttctcatttcgcat
tctgataccatacaagcaatcctgcgctgtcaagatgttagtgctgggtctttgcaggaa
ttggctctactgacaggaattataagtaaagcaggacttcctggtatattaagtgaactt
gatgttgacgtaaacgaaggatctctaatggagctacagggacatattggaagattccag
cgccagtgcttagggttactaagtcgctttggtggctccgacagactacgtcagtttaaa
tttcaagatgataatgtggagggagataaagtgagcaagaaagatgagattgaattggct
atgcaacagatttgtgccaacgtcatggaatattgccagtcactcatgttacagagttcc
cctacctttcagcatgctgtgtgtctctttacccctagcctgtcagaaaccattaataga
gatggcccccggcaagatacccaagctccagtagttccgtattggcgcctgcctggtttg
ggcattatcatctacctgctgaaacagagtgctaatgatttcttcagctattatgacagt
catcgacggagtgtcaataagctacagaatgtggagcagcttccaccagatgagataaaa
gagttgtgtcagtctgtgatgcctgctggtgttgataaaatctccactgcccagaagtat
gttctagcgagaaggcgtttggtgaaattgatcaataatcgagctaaactgctctccctc
tgttcttttatcatagagacctgcctatttattctttggcgccatttggagtactacttg
ttacattgtacacccacggattctcaagattccttatttgcctccagggccttatttaaa
agcagaagactacaagattcctttgcttcagaaaccaatctggattttagaagtggactg
actgtggtaagccaacatgacatagaccagcttcaggctgacgccatcaacgcttttgga
gaatcactacaaaagaaacttctggacattgaaggattatattcaaaagttcgatctcgc
tatagtttcatacaagctcttgtcagacgtatccgaggcttactgaggatatcacggaac
tga

DBGET integrated database retrieval system