KEGG   Equus caballus (horse): 100064995Help
Entry
100064995         CDS       T01058                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100064995 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1966 aa AA seqDB search
MATLLAVNSAASLWGPYKDIWQTVGNALWRRQPEAVHLLDMILKKHKPDFISLFKNPEEK
NTKQWDIEGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPEL
VSMTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQ
SLAESLFAWACQSPLGKDDTLLLIGHLERVTVEANGSLDSVNLALLMALLYCFDTSFIEQ
STEERDDMIHQLPLLTEKQYIATIHSRLQDSQPWKLPGLQAIVRLAWALALRGISQLPDV
TALAEFTEADEAMAELAIADNVFLFLTESVVVSENFYQEEFYIRRIHNLITDFLALMPMK
VKQLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFNLELALEYWCP
SEPLQTSTILGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQC
AHYCFSLLKVNGSSHVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPS
RGITQKEQDGLIAFLQLTSTIISWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAEL
LKTLAAFGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRA
FCQLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVL
EVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEG
VKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGI
NPRTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSVSQK
LMAGFVECLDSEDAEEFVRLEEGSELERXLAGIRHETRIHILNLLITSLERNPPNLALYL
LGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQV
IYQLCACSDTSGPTMRYLRTSQDFLFSQLQHLPFSNKEYEISMLNQMSWLMKTASIELRV
TSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGLEDENRSISGFLHFDTATKVRRKILSIL
DSIDFSQEIPEPLQLDFFDRVQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGM
AAIGQRPLLMEEISTILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQSED
RQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVLGPGEAP
YAFMLDSSFTSPPPAENPLVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLL
YYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDAC
DGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDHTLQSLLTPQPPL
LKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGMFGMRDPP
VFIPSPVDRYRQILLPALRLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVS
AGSLQELALLTGIISKAGLPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSD
RLRQFKFQDDNVEGDKVSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSL
SETINRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRRSVNKLQNVEQL
PPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETCLFILWR
HLEYYLLHCTPTDSQDSLFASRALFKSRRLQDSFASETNLDFRSGLTVVSQHDIDQLQAD
AINAFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 5901 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctgttggcggtaaattcggctgctagtctctggggtccttacaaagacatc
tggcaaacagtgggcaacgctctttggagaagacaacctgaagctgtccatcttcttgat
atgattttgaagaaacacaaacctgacttcatctcattgttcaaaaacccagaagaaaag
aacacaaagcagtgggatatagaaggagagcaccaacagccgcattttcctggcctcact
agaggattagtagctgttcttttatactgggatggaaaacgatgcattgcaaattccctg
aaagccttgatacagtctagacgaggaaagacatggacccttgaactcagtccagagcta
gtttccatgacaacacgctttacagatgagctgatggagcaaggattgacttacaaagtc
cttactctggtgtcacagattgatgtgaacaatgagtttgaaaaactgcagcgcgagaga
ggcttgggcagtgaaaaacatcgcaaagaggtttctgatctcatcaaggagtgcaggcag
tctctagcagaaagcctttttgcctgggcttgccagtcacctttaggcaaagatgacact
cttctccttattggacatttggagagagtgacagttgaggctaatggctcattggactca
gtgaatctggctcttcttatggcacttctctactgctttgataccagttttatagaacaa
agcacagaggaacgtgatgatatgattcatcaacttccgctgttgacggagaaacaatac
attgcaacaattcactctcgccttcaagactcacagccttggaaactgcctgggctgcaa
gccattgttagacttgcctgggcactggcattgaggggaatatctcagctacctgatgtg
acagcactggctgaattcacagaagcagatgaagcaatggcagagctcgcaattgctgac
aatgtttttctgttcctcactgaatctgtggtggtatcagaaaacttctatcaggaggaa
ttttatattcgtagaatccataatctcatcacagatttccttgcgcttatgccaatgaag
gtgaagcagttgaggaatcgggcagatgaagatgctcgaatgattcacatgagtatgcag
atgggtaatgaaccccccatttcacttagaagggatctggaacacttaatgctcttgatt
ggtgagctatataaaaagaacccttttaatttggagcttgctctagaatattggtgtccc
tcagagcctcttcagacttccactatcctgggctcttaccttggggtggctcatcagcga
ccccctcaacgccaggttgtcttgtcaaaatttgttaggcaaatgggtgatctgttgcct
ccaactatttatattccttatttgaaaatgctccagggattggccagtgggccccagtgt
gcccactactgttttagcctgctcaaagtcaatggtagtagtcatgttgaaaatattcag
ggagcaggtggaagtcctgtttcttgggaacatttctttcactccttaatgctttaccat
gaacacctccggaaggaccttccgagtgcagatagtgtccagtaccgtcaccttccttca
cgtggcatcacccagaaggagcaagatggattgattgcttttttacagctcacatctacc
atcattagttggagtgaaaatgctcgtctggcactctgtgagcatcctcagtggacgcct
gttgtggtgatcctgggactcctgcaatgcagtattccccctgttctaaaagctgaacta
ctgaagacacttgcagcttttggaaaatctcctgaaattgctgcttccctctggcagtca
ttggaatacactcagatacttcagaccgtaagggttccaagccagaggcaagctattggt
attgaggttgaactaaatgaaatagaatcgcggtgtgaggaatacccgttgactcgggcc
ttttgccagcttattagtaccctggtggagagctcatttccttctaatctgggcgctgga
ctgcggccccctggctttgacccttatttgcagttccttagagattctgtgtttctccga
ttccgcacaagagcttaccggagagcagctgaaaagtgggaagttgctgaggttgttttg
gaggtgttttataaattgctcagagattatgagcctcaactcgaagattttgtagaccag
tttgtggagctacaaggagaagaaatcatagcctataagccaccaggatttagtctgatg
tatcatcttctgaatgagtcaccaatgttggagcttgctcttagtttactggaagaaggc
gtgaagcagcttgatacctatgcccctttccctgggaagaaacacttggagaaagcagta
cagcattgccttgcacttctcaatcttactctacaaaaggaaaatctgtttatggatctt
ctgagagagagtcagctggctctcatagtctctcctttagaacagctgctgcagggaatc
aatcccagaactaagaaggctgataatgtggtgaatattgccagatatctctatcatggc
aatactaatccagaactggcttttgaaagtgccaagatcctctgctgtatctcttgcaac
tccaacattcagataaaattggttggagatttcacacatgaccagagtgtaagtcagaag
ctgatggctgggtttgtggagtgcttggatagtgaagatgcagaagaatttgtacgtctg
gaagagggatcagaacttgaaagannattagctggaatccgtcatgaaacaagaatccac
atcttgaatcttcttatcacctctctggaacgcaatccaccaaatcttgctctctatctg
ttgggctttgaattgaagaaacctgtcagtaccacaaacctacaagatccaggagtgtta
ggttgccctcggacatgccttcatgccatcttaaacatcttggagaaaggaactgaaggg
agaacaggcccggtggcagtgagagaatctcctcaactcgctgagctgtgttaccaggtg
atatatcagttatgtgcatgctctgatacatctggtcctactatgagatacttgagaacc
agccaggatttcttattttctcagttgcagcatttaccattttctaacaaagaatatgaa
atatctatgctgaaccaaatgtcatggctgatgaagactgcttcaatagaactgagggta
acttctctgaatcgtcaacggtcacatacccagaggctcctgcaccttttattggatgac
atgccagtaaaaccatactcagatggtgaaggaggactagaagatgaaaataggtccatc
tctgggttccttcactttgacactgccacgaaagtacgtcgaaaaattctaagcattctc
gactcgattgacttcagtcaggagatccctgagcctttgcagttggatttctttgatcgg
gtccagattgaacaagttattgccaactgtgaacacaagaatttacggggacagacagtc
tgcaatgtcaagcttcttcatagggttcttgtagctgaagtcaatgctcttcagggtatg
gcagccataggacagagacctctactaatggaggaaatcagcacaatacttcagtatgtg
gtaggaagaaacaaactgctgcagtgtcttcatgcaaagcggcatgcgctggagtcatgg
aggcagctggtggaaattatactgacagcttgtccccaggacctcattcagtcagaggat
cgacaactgattattcgtgatattttacaagatgtgcatgataagatactggatgacgaa
gcagcacaggagttaatgccagtggtagcaggtgctgtgttcaccctgacggctcaccta
agccaagccgttcgcacggaacagaagcaaccattggtcctgggacccggagaggcccct
tacgcttttatgcttgatagctctttcacctcacctcctccagcagagaacccactggtg
ggttttgcttctattggagattcttcacttcacatcatattgaagaaactgttagacttc
attttgaagacaggtggcggattccagcgagtgaggacacacctgtatggctctctgctt
tattacttacagatcgcccagagacctgatgaaccagacaccttagaagcagccaagaaa
accatgtgggaaaggctgacagcccctgaagatgtatttagtaaattacagcgagaaaac
atagccatcattgagagctacggtgctgctctcatggaagtggtctgtcgagacgcttgt
gatggtcatgagattggaaggatgctggcactggctctccttgatcggattgtctctgta
gataagcagcagcagtggcttttgtatctttctaacagtggctatttgaaggtgcttgtg
gacagcttggtagaagatgaccatactttgcagagcttactcactccacaacctcccctt
ttaaaagccctttatacttacgaatctaaaatggcatttctcacaagagtggctaagata
cagcagggcgctttagagctgctgaggtctggggtcattgtgagactggcacaatgccaa
gtctatgacatgcgcccggaaatggacccgcagggcatgtttggcatgagagatccccca
gtgttcatcccttctccggtggaccggtaccgtcaaattctccttccagctctccgcttg
tgtcaagttatcctcacatctagtatggcccagcacttgcaggcagcagggcaggtgctg
cagtttctcatttcgcattctgataccatacaagcaatcctgcgctgtcaagatgttagt
gctgggtctttgcaggaattggctctactgacaggaattataagtaaagcaggacttcct
ggtatattaagtgaacttgatgttgacgtaaacgaaggatctctaatggagctacaggga
catattggaagattccagcgccagtgcttagggttactaagtcgctttggtggctccgac
agactacgtcagtttaaatttcaagatgataatgtggagggagataaagtgagcaagaaa
gatgagattgaattggctatgcaacagatttgtgccaacgtcatggaatattgccagtca
ctcatgttacagagttcccctacctttcagcatgctgtgtgtctctttacccctagcctg
tcagaaaccattaatagagatggcccccggcaagatacccaagctccagtagttccgtat
tggcgcctgcctggtttgggcattatcatctacctgctgaaacagagtgctaatgatttc
ttcagctattatgacagtcatcgacggagtgtcaataagctacagaatgtggagcagctt
ccaccagatgagataaaagagttgtgtcagtctgtgatgcctgctggtgttgataaaatc
tccactgcccagaagtatgttctagcgagaaggcgtttggtgaaattgatcaataatcga
gctaaactgctctccctctgttcttttatcatagagacctgcctatttattctttggcgc
catttggagtactacttgttacattgtacacccacggattctcaagattccttatttgcc
tccagggccttatttaaaagcagaagactacaagattcctttgcttcagaaaccaatctg
gattttagaagtggactgactgtggtaagccaacatgacatagaccagcttcaggctgac
gccatcaacgcttttggagaatcactacaaaagaaacttctggacattgaaggattatat
tcaaaagttcgatctcgctatagtttcatacaagctcttgtcagacgtatccgaggctta
ctgaggatatcacggaactga

DBGET integrated database retrieval system