KEGG   Equus caballus (horse): 100065012Help
Entry
100065012         CDS       T01058                                 

Gene name
MYL7
Definition
(RefSeq) myosin regulatory light chain 2, atrial isoform isoform X1
  KO
K12754  myosin regulatory light chain 7
Organism
ecb  Equus caballus (horse)
Pathway
ecb04510  Focal adhesion
ecb04670  Leukocyte transendothelial migration
ecb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100065012 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100065012 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100065012 (MYL7)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100065012 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 CHCH EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100065012
NCBI-ProteinID: XP_023494755
Position
4
AA seq 179 aa AA seqDB search
MASRKAGTRGKAGATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAECLPQVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggaccaggggcaaggccggggccaccaagcaggcccaacgt
ggctcttccaacgtcttttcgatgttcgagcaagcccagatccaggagttcaaggaagcc
ttcagctgcatcgaccagaaccgggatggcatcatctgcaagtcagaccttcgggagacc
tactcccagctcgggaaggtgagtgtcccagaagaggagctggacgccatgctgcaggag
gggaagggccccatcaacttcaccgtcttcctcacgctcttcggagagaagctcaacggg
acagaccccgaggaagccatcctgagcgccttccgcatgtttgaccccagtggcaaaggc
gtagtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaaattctctccg
gctgagtgcctcccccaggtggagcagatgtttgccctgacgcccatggacctggcaggg
aacatcgactacaagtccctgtgttacatcatcacccatggggacgagaaggaggagtga

DBGET integrated database retrieval system