KEGG   Equus caballus (horse): 100065012Help
Entry
100065012         CDS       T01058                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
ecb  Equus caballus (horse)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100065012 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100065012 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100065012 (MYL7)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100065012 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 204 aa AA seqDB search
MLWGCALRGSFGEPGRGPLPTPQCCRASRKAGTRGKAGATKQAQRALQRLFDVEQSDQSQ
KLWPPTSQAFSCIDQNRDGIICKSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFL
TLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTP
MDLAGNIDYKSLCYIITHGDEKEE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggggtgtgcactgcgggggtcttttggggagccagggagaggacccctcccc
accccacagtgttgcagggccagcaggaaggcggggaccaggggcaaggccggggccacc
aagcaggcccaacgtgctcttcaacgtcttttcgatgtcgagcagtcagatcagagtcag
aaactgtggccccctacctcacaggccttcagctgcatcgaccagaaccgggatggcatc
atctgcaagtcagaccttcgggagacctactcccagctcgggaaggtgagtgtcccagaa
gaggagctggacgccatgctgcaggaggggaagggccccatcaacttcaccgtcttcctc
acgctcttcggagagaagctcaacgggacagaccccgaggaagccatcctgagcgccttc
cgcatgtttgaccccagtggcaaaggcgtagtgaacaaggatgagttcaagcagcttctc
ctgacccaggcagacaaattctctccggctgaggtggagcagatgtttgccctgacgccc
atggacctggcagggaacatcgactacaagtccctgtgttacatcatcacccatggggac
gagaaggaggagtga

DBGET integrated database retrieval system