KEGG   Equus caballus (horse): 100065012Help
Entry
100065012         CDS       T01058                                 

Gene name
MYL7
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
ecb  Equus caballus (horse)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100065012 (MYL7)
  Cell communication
   04510 Focal adhesion
    100065012 (MYL7)
   04530 Tight junction
    100065012 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100065012 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 189 aa AA seqDB search
MRLLLWHSCCRASRKAGTRGKAGATKQAQRALQRLFDVEQSDQSQKLWPPTSQAFSCIDQ
NRDGIICKSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEA
ILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYI
ITHGDEKEE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgctctggcacagttgttgcagggccagcaggaaggcggggaccaggggc
aaggccggggccaccaagcaggcccaacgtgctcttcaacgtcttttcgatgtcgagcag
tcagatcagagtcagaaactgtggccccctacctcacaggccttcagctgcatcgaccag
aaccgggatggcatcatctgcaagtcagaccttcgggagacctactcccagctcgggaag
gtgagtgtcccagaagaggagctggacgccatgctgcaggaggggaagggccccatcaac
ttcaccgtcttcctcacgctcttcggagagaagctcaacgggacagaccccgaggaagcc
atcctgagcgccttccgcatgtttgaccccagtggcaaaggcgtagtgaacaaggatgag
ttcaagcagcttctcctgacccaggcagacaaattctctccggctgaggtggagcagatg
tttgccctgacgcccatggacctggcagggaacatcgactacaagtccctgtgttacatc
atcacccatggggacgagaaggaggagtga

DBGET integrated database retrieval system