KEGG   Equus caballus (horse): 100065012Help
Entry
100065012         CDS       T01058                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
ecb  Equus caballus (horse)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100065012 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    100065012 (MYL7)
   04530 Tight junction
    100065012 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100065012 (MYL7)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100065012 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 204 aa AA seqDB search
MLWGCALRGSFGEPGRGPLPTPQCCRASRKAGTRGKAGATKQAQRALQRLFDVEQSDQSQ
KLWPPTSQAFSCIDQNRDGIICKSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFL
TLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTP
MDLAGNIDYKSLCYIITHGDEKEE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggggtgtgcactgcgggggtcttttggggagccagggagaggacccctcccc
accccacagtgttgcagggccagcaggaaggcggggaccaggggcaaggccggggccacc
aagcaggcccaacgtgctcttcaacgtcttttcgatgtcgagcagtcagatcagagtcag
aaactgtggccccctacctcacaggccttcagctgcatcgaccagaaccgggatggcatc
atctgcaagtcagaccttcgggagacctactcccagctcgggaaggtgagtgtcccagaa
gaggagctggacgccatgctgcaggaggggaagggccccatcaacttcaccgtcttcctc
acgctcttcggagagaagctcaacgggacagaccccgaggaagccatcctgagcgccttc
cgcatgtttgaccccagtggcaaaggcgtagtgaacaaggatgagttcaagcagcttctc
ctgacccaggcagacaaattctctccggctgaggtggagcagatgtttgccctgacgccc
atggacctggcagggaacatcgactacaagtccctgtgttacatcatcacccatggggac
gagaaggaggagtga

DBGET integrated database retrieval system