KEGG   Equus caballus (horse): 100065012Help
Entry
100065012         CDS       T01058                                 

Gene name
MYL7
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
ecb  Equus caballus (horse)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ecb04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:ecb04510]
Cellular Processes; Cell communication; Tight junction [PATH:ecb04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:ecb04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 189 aa AA seqDB search
MRLLLWHSCCRASRKAGTRGKAGATKQAQRALQRLFDVEQSDQSQKLWPPTSQAFSCIDQ
NRDGIICKSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEA
ILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYI
ITHGDEKEE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgctctggcacagttgttgcagggccagcaggaaggcggggaccaggggc
aaggccggggccaccaagcaggcccaacgtgctcttcaacgtcttttcgatgtcgagcag
tcagatcagagtcagaaactgtggccccctacctcacaggccttcagctgcatcgaccag
aaccgggatggcatcatctgcaagtcagaccttcgggagacctactcccagctcgggaag
gtgagtgtcccagaagaggagctggacgccatgctgcaggaggggaagggccccatcaac
ttcaccgtcttcctcacgctcttcggagagaagctcaacgggacagaccccgaggaagcc
atcctgagcgccttccgcatgtttgaccccagtggcaaaggcgtagtgaacaaggatgag
ttcaagcagcttctcctgacccaggcagacaaattctctccggctgaggtggagcagatg
tttgccctgacgcccatggacctggcagggaacatcgactacaagtccctgtgttacatc
atcacccatggggacgagaaggaggagtga

DBGET integrated database retrieval system