KEGG   Equus caballus (horse): 100065074Help
Entry
100065074         CDS       T01058                                 

Gene name
USP40
Definition
(RefSeq) ubiquitin specific peptidase 40
  KO
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100065074 (USP40)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100065074 (USP40)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100065074 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1248 aa AA seqDB search
MPFSLRVVFSFTMFGDLFEEDDSSVSHNQYGKGKKLKTKAVEPPPPREFTNLSGIRNQGG
TCYLNSLLQTLHFTPEFREALFSLGPEELGSLEDKDKPDAKVRIIPLELQRLFAQLLLLD
QEAASTADLTDSFGWTSNEEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGTIVN
QIVCKECKNVSEKQEDFLDLTVAVKNVSGLEDALWNMYVEEEIFDSDNLYHCGTCDRLVK
AAKSAKLRKLPPFLTVSLLRFNFDFVKCERYKETSCYTFPLRINLKPFCEQSELDDLEYV
YDLFSVIIHKGGCYGGHYHVYIKDVDHLGNWQFQEENSKPDVNLKDLQNEEEIDDPLMIL
KTILLQEESNLLPVDQLGQKLLKKIGISWNKKYRKQYGPLRKFLQLHSQTFLLSSDESTV
RLLKNSTLQAEPDFQRNDQQIFKTLPSESPGFNGRTSCPHWFDINDSKVQPIKEKDIQQQ
FQGKESAYMLFYRKSQLQRPPEARGNPRYRVPRHLLSEMDAANIELQTKRAECDSTENNF
ELHLHLGPHYHFFNGALHPVGSQTESVWDLTFDKRKTLGDLRQSIFQLLEFWEGDMVLSV
AKLLPAGLHVYQTLDGDSLTLSEIELADGEDIFVWNGVEVGGIQIPAGRDCEPLLLNVLH
LATSSEGGKCQQLIEFPHVFPSNAEVGTVFTSLAIPGGVVLINNTESIGEKNWTTIPKVD
LKKTFREQGLRNGSSILIRDSNHDNSLLAKQEKWITSMNEIDWLQVKNLCELESEEEQVR
ISATVNTVVFDIRIKAIQELKLMKELAENSCLRPIDRNGKLLCPVPDNYTLKEAGLKMGS
SLGLCPGRAPTSSQLFLFFAVGSDVQPGTEMEIIVEETLSVRDCLKIMLEKSGLLGDAWH
LRKMDWCYEAGEPLCDEDATLKELTICSGDTLLLIEGKLPPLGFLTVPIWWYQPQHPSGH
WKSHQDRRNCTPSQGGIWRAISAQGAPGDVHAEVSLHYLGDIDISEDATLMELKSQAMTL
PSFSEFVIPSPAFLRAWTVESKRPSRLLRADQQQLKEYKLGRRTEICLEPLQKEENLGPQ
DVLLRTQMRLPGERAYALPMNMVWDAARGWTAGSLRQRVADFYSLPVEKIEIAKYFPEKF
EWLPISSWNQQITKRKKKKKQDNLQGAPYHLKDGDTIGVKNLLAEDDDDFSTVTDDIGKE
KQKQLALGKRKSQEALRVQSSHVFSGAETPARPRGPEASLSIHVGSFR
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgcctttttctttaagggtagtatttagtttcacaatgtttggggacctatttgaagag
gatgattccagtgtgtcacataatcagtatggaaaagggaagaaattaaagaccaaagct
gtggagccccctcctcctagagaattcaccaatttaagcggaatcagaaatcagggtgga
acctgttacctcaattcccttcttcagactcttcatttcacccctgaattcagagaagct
ttattttctcttggcccagaagagcttggttcgttagaggataaggataaacctgatgca
aaggttcgaatcatacccttagagttacagcggctgtttgctcagcttctgctcttggac
caggaagctgcatccacagccgacctcacagacagctttgggtggaccagcaatgaggaa
atgaggcaacatgatgtgcaggaactgaatcgaattctctttagtgctttggaaacttct
ttagtcgggacctccggccacgacctcatcaatcgtctctatcacggaaccattgttaac
cagattgtttgtaaagaatgtaagaatgtcagtgaaaagcaggaagacttcttagatcta
acagtagcggtcaaaaatgtgtcaggtttggaagatgctctctggaacatgtatgtagaa
gaggaaatttttgactctgacaacttataccactgtggaacttgtgacaggctggttaaa
gcggcgaagtcagccaaattacgtaagctgcctccctttcttactgtttcgttgttaaga
tttaattttgattttgtgaagtgtgaacgatacaaggaaactagctgttataccttccct
ctccggatcaatctcaagcctttttgtgaacagagtgaattagatgatttggaatatgta
tatgacctcttctcagttattatacacaaaggtggttgctatggaggacattatcatgtg
tatattaaagatgttgatcatttgggaaactggcagtttcaagaggaaaatagtaaacca
gatgtgaatttgaaagaccttcagaatgaagaagagattgatgatccactgatgattcta
aaaacaatcttattacaggaggagagtaatctacttcctgttgatcagctgggccagaaa
ctcttgaaaaagataggaatatcttggaacaagaagtatagaaaacagtatggaccgttg
cgaaagttcttacagcttcattctcagacatttctactcagttcagatgaaagtacagtt
cgtctcttgaagaactctactctccaggctgagcctgatttccaaaggaatgatcaacaa
attttcaagacccttccttcagaatccccaggattcaatggtagaacgtcctgtccccac
tggtttgatataaatgattccaaagtccaaccgatcaaggaaaaggatattcaacagcag
tttcagggtaaagaaagtgcctacatgttgttttatcggaaatcccagttgcagagaccc
cctgaagctcgaggtaatccgagatacagggttccacgtcatttgctgagtgaaatggat
gcagccaacattgaactgcaaacaaaaagggcagaatgtgactctacagaaaataatttt
gaattgcatctccacctgggccctcattatcatttcttcaacggggctctgcacccagta
ggctctcaaacagaaagcgtgtgggatttgacctttgataaaagaaaaactttaggagac
cttcgacaatcaatatttcagctgttagaattttgggaaggagatatggttcttagtgtt
gcaaagcttttaccagcaggacttcacgtttaccagacgcttgatggagacagcctgaca
ctgagtgaaattgaacttgctgatggggaagacatctttgtatggaatggggtggaggtt
ggtggaatccagattccagctggtagggactgcgaacctctgcttttaaatgttcttcat
ctagcaacgagcagtgaagggggaaagtgtcagcagttgatagaatttccacacgtcttc
ccatcgaatgcagaagtaggcactgtattcacatctttagcaatcccaggaggtgttgtc
ttaatcaacaatactgaatctataggagaaaagaactggaccaccattcccaaggtagac
ttgaagaagacattcagagaacaaggtctcagaaacggaagctcaattttaattcgggat
tctaatcatgataacagtttgttggccaaacaagagaaatggatcactagtatgaatgaa
attgactggctccaagttaaaaatttatgcgaattagaatctgaagaggagcaagttaga
atatcagcaactgttaacacagtggtgtttgatattcgaattaaagccatacaggaatta
aaattaatgaaggaactagctgagaacagctgtttgagacctattgatagaaacgggaag
ctgctttgtccagtcccagacaattatactttgaaggaagcaggactgaagatggggagt
tccctggggctgtgtcctggaagggcaccgacttcctcccagctgttcctgttttttgcc
gtggggagtgatgttcagcctgggacagagatggagatcatagtagaagaaacgctatct
gtgagagattgtttaaagataatgctggagaaatctggcctactaggagacgcatggcat
ttacgaaaaatggattggtgctatgaagctggggagcctttatgtgacgaagatgcaaca
ctgaaagagcttacgatatgttctggagatactttgcttttaattgaaggaaaacttcct
cctctgggtttcctgacggtgcccatctggtggtaccagcctcagcatccctcgggtcac
tggaagagtcatcaggaccggaggaactgtaccccttctcaaggtgggatctggagagct
atttccgcccaaggtgctcctggtgacgtacatgcagaagtctccctccactacttggga
gacattgacatctcagaagatgccaccttgatggagctgaagtctcaggccatgaccttg
ccctccttctcggagtttgtcatcccatccccagccttcctcagagcctggacggtggaa
agtaagcgccccagcaggctcttacgagctgaccagcagcagctcaaggaatataaactg
ggcaggagaactgagatctgcttagagccccttcagaaagaagaaaacttgggcccccag
gacgtgctgctgaggacgcagatgcgcctccctggcgagagggcatacgccctgcccatg
aacatggtgtgggatgctgcccgaggctggactgctggctccctgaggcagcgagttgct
gatttctattctcttcctgtggaaaaaattgaaattgccaaatactttcctgaaaagttt
gaatggcttccaatatctagctggaaccagcaaattactaagaggaaaaagaagaaaaag
caagataatttgcagggggcgccttatcacttgaaagatggcgatactattggtgttaag
aatctcctggctgaagatgatgatgatttcagtacagtcacggatgacattggaaaagaa
aaacagaaacagctggctctgggcaaaaggaaaagccaagaagccctgcgtgtccagagc
agccatgttttctctggtgcagagacgcctgcccggccccgtggaccagaagcttctctc
tccatccacgttgggagtttcaggtag

DBGET integrated database retrieval system