KEGG   Equus caballus (horse): 100065185Help
Entry
100065185         CDS       T01058                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
ecb  Equus caballus (horse)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100065185 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100065185 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100065185 (CCNH)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100065185 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFANEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEMLRKTADDFLNRVALTDAYLLYTPSQIALTAVLSSASRAGISMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRPEEVAILKQKLERCHSAELALNVITKKRKGYEDD
DYISKKSKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagcagccagaagcggcactggacttttgccaatgaggagcagctggca
cggctgcgagccgacgccaaccgcaagttcaaatgcaaagcggtggcgaacgggaaggtt
cttccaaatgatccagtctttcttgaacctcatgaagaaatgacactctgcaaatattat
gagaaaagattattggaattctgttccgtgtttaagccagcaatgccaaggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttaccttaataactcagtaatggagtatcac
ccccggataataatgcttacttgtgcatttttagcctgcaaagtagatgaattcaatgtc
tctagtccacagtttgttggaaatctgagggagagtcctcttggacaggagaaggcactt
gaacagattctggaatacgaactacttcttatacagcagcttaatttccaccttattgtc
cacaatccttataggccgtttgagggcttcctcattgatataaagactcgctatcccatg
ttggagaatccagagatgctgaggaaaacagctgatgactttcttaatagagttgcattg
acggatgcttaccttttgtacacaccttcccagattgccctgactgccgttctatctagt
gcatccagagcaggaatttctatggaaagttatttatcagaaagtctgatgctgaaagag
aatagaacttgcttgtcacagttactagatataatgaaaagcatgagaaacttggtaaaa
aaatatgaaccacccagacctgaagaagttgctattctaaaacagaagttagagagatgt
cactctgctgagcttgcgcttaatgtaattacgaagaagaggaaaggctatgaagatgat
gattacatctcaaagaaatccaaacatgaggaggaagaatggaccgatgatgacctggta
gattctctctaa

DBGET integrated database retrieval system