KEGG   Equus caballus (horse): 100065302Help
Entry
100065302         CDS       T01058                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
ecb  Equus caballus (horse)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:ecb03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 333 aa AA seqDB search
MERKVSRIYLASEPGIIHFLQIAWEKTLGSGFVITLTDGQSAWTGTVCESEISQEADDMA
MEKEKYVDELRKALVSGAGPTDAYKFNFSKESCHFSFEKNLKDVSFRLGTFNLEKVASPA
EVIRELICDCLDTIAENQAKNEHLRKENERLLRDWNDVQGRFEKCVSAKEAVEADLYKRF
ILVLNEKKAKIRSLHKLLNEVQELEKNMEHEKETTTCSEMTADRDAAYDESTDEDSENVP
DPSGSAPATLRRDDSIISSPDVTDIAPTRKRRQRMPKNLGTESKMASQEKQHQEKAKHEP
PLPEALRKEHSSAENMSLETLRNRSPEDLFDEI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaagtaagcagaatctatcttgcttctgaacctggtataattcattttcta
caaattgcttgggagaaaacactaggatctggtttcgttattacacttactgatggtcag
tcagcatggaccgggacagtttgtgaatcagagatttcccaagaagctgatgacatggca
atggaaaaagagaaatatgttgatgaactgagaaaagcattggtgtcaggagcaggacca
actgacgcatacaagtttaatttttctaaagagtcttgtcatttctcctttgagaaaaac
ctgaaagatgtttcattcagacttggtaccttcaacctagagaaagttgcaagcccagct
gaggtcattagagagcttatatgtgactgcctggacaccattgcagaaaaccaagccaaa
aatgagcacctgcggaaagaaaatgaaaggcttctgagagactggaatgacgttcaagga
cgatttgaaaaatgtgtgagtgccaaggaagctgtggaggctgacctttataaacggttt
attctggtgctgaatgagaagaaagcaaagatcagaagcttacataaattgttaaatgaa
gttcaagaactagaaaagaacatggaacatgaaaaggaaactacaacatgttctgaaatg
actgctgacagagatgcagcgtatgatgaaagtactgatgaggacagtgaaaacgtgcct
gatccctctgggtcagctccagctactttaagaagagatgattctattatttcaagtcct
gatgtcactgatattgcaccaactagaaagaggaggcagcggatgccaaaaaatcttggg
acagaatccaaaatggcttctcaggagaaacagcatcaagaaaaggcaaagcatgaacct
ccactacctgaggcgttgagaaaggagcacagctcagctgaaaacatgtctttagaaact
ctaagaaacaggagtccagaagacctctttgatgagatttaa

DBGET integrated database retrieval system