KEGG   Equus caballus (horse): 100065597Help
Entry
100065597         CDS       T01058                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100065597 (GEMIN7)
Spliceosome [BR:ecb03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100065597 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 131 aa AA seqDB search
MQTPLTIPVPVLRLPRGPDGWSRGFAPDGRRAPLKPEVPGIPESPGVPESQESQEQRARA
ALRERYLRSLLAMVGRQVSFTLHEGVHVTAHFGATDLDVANFYVSQLQTPIGVQAEALLR
CSDIIAYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcagactccactgaccattcctgtgcctgtgctccgcctcccccggggccctgatggc
tggagccgaggctttgcccccgatggacgcagggcccccctgaagccagaggttcctgga
atcccagagtctcccggagttccagaatcccaggaatcccaggaacagcgggcccgagcc
gcccttcgggaacgctacctccgcagcctgctggccatggtgggccgccaggtgagcttc
acattgcacgagggcgtgcatgtgactgcccacttcggagccactgacctggacgtggcc
aacttctacgtgtcgcagctgcagactccgataggtgtgcaggctgaggcgctgctccgg
tgtagcgacatcattgcatacaccttcaagccctaa

DBGET integrated database retrieval system