KEGG   Equus caballus (horse): 100065597Help
Entry
100065597         CDS       T01058                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ecb03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 131 aa AA seqDB search
MQTPLTIPVPVLRLPRGPDGWSRGFAPDGRRAPLKPEVPGIPESPGVPESQESQEQRARA
ALRERYLRSLLAMVGRQVSFTLHEGVHVTAHFGATDLDVANFYVSQLQTPIGVQAEALLR
CSDIIAYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcagactccactgaccattcctgtgcctgtgctccgcctcccccggggccctgatggc
tggagccgaggctttgcccccgatggacgcagggcccccctgaagccagaggttcctgga
atcccagagtctcccggagttccagaatcccaggaatcccaggaacagcgggcccgagcc
gcccttcgggaacgctacctccgcagcctgctggccatggtgggccgccaggtgagcttc
acattgcacgagggcgtgcatgtgactgcccacttcggagccactgacctggacgtggcc
aacttctacgtgtcgcagctgcagactccgataggtgtgcaggctgaggcgctgctccgg
tgtagcgacatcattgcatacaccttcaagccctaa

DBGET integrated database retrieval system