KEGG   Equus caballus (horse): 100065646Help
Entry
100065646         CDS       T01058                                 

Gene name
KCNMB3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
ecb  Equus caballus (horse)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100065646 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100065646 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100065646 (KCNMB3)
Ion channels [BR:ecb04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100065646 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 172 aa AA seqDB search
MQPFSIPVQITLQDGRHRQGRTASSASERKRKIHNDGDPPDVXKKLPSSAGEDRAMLLGF
TMMGFSVLMFFLLGITILKPFMLSTQREESNCTIIHTHITDDWMDCGFPCGVDRRGQGKY
PCLQVLVNLTHSGQKALLRYNKEAVQINSKRDVTDCKVKEKQTLTVSDEHKQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcagccattcagcatccccgttcaaattacactccaggatggccggcaccgccagggg
aggacagcctcttctgcctcagagaggaagagaaagatacacaatgatggagacccacca
gatgtgncaaagaagctgccgtccagtgcaggagaggaccgagccatgctgctggggttt
acaatgatgggcttctcagtcctcatgttcttcttgcttgggataaccatcctaaagcct
ttcatgctcagcactcagagagaagaatcaaactgcaccatcatccacacgcatatcaca
gatgactggatggactgtggattcccctgcggtgtggaccgccgaggccagggcaagtac
ccgtgtctccaggtattggtgaacctcacccattcaggacagaaagctctcctacgttat
aacaaagaggctgtccagataaattccaagcgtgatgttacagactgcaaagttaaagaa
aagcagacattgacagtttctgatgagcacaaacagtaa

DBGET integrated database retrieval system