KEGG   Equus caballus (horse): 100065844Help
Entry
100065844         CDS       T01058                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100065844 (USP13)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100065844 (USP13)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100065844 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 798 aa AA seqDB search
MNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDD
LNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENE
LPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHA
LEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHGTENGL
RDNDIKPRVSEWEVIQETGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQRAYV
GNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQQNGIS
PRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQ
TRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPEVVRAKIPFSACL
QAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDM
PDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQFIDPSDIDESSVMQLAEMG
FPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGATGLD
NQPPEEIVAIITSMGFHRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNAN
ANIISEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDHKVCAS
ERPPKDLGYMYFYRRIPS
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatttttggcctttggaagggaacatgttgaaagacattttcgaaaaactgga
cagagtgtgtacatgcacctgaagagacatgtacgagagaaggtaagaggggcatctggt
ggagctttaccaaaaaggaggaattcaaagatttttttagatctagatactgatgacgat
ttaaatagcgacgattatgaatatgaagatgaagccaaacttgttattttcccagaccac
tatgaaatagcactaccaaatattgaggagttaccagccctggtaacaattgcttgtgat
gcagttctcagctcaaaatctccatacagaaagcaggacccagacacttgggaaaatgaa
ttgccagtatccaaatatgccaataacctcacccagctggacaatggagtcaggattcct
ccaagtggttggaagtgtgccaggtgtgacctgcgggaaaacctctggttaaatctgacc
gatggctctgtgctgtgtgggaagtggttctttgacagctctgggggcaacgggcatgca
ctggagcattacagagacatgggctaccctctagctgtgaagctgggaaccatcactcct
gatggggcagatgtttattcttttcaagaagaggaacccgttttggatcctcatttggcc
aagcacttagcgcattttggaattgatatgcttcacatgcacgggacagagaatgggctc
cgggacaatgacatcaagcctcgtgtcagcgagtgggaagtgatccaggagacggggacg
aagctgaagcccatgtatggccctggatacacgggtctcaagaacctggggaacagctgc
tatctcagttctgtcatgcaggccatcttcagcatcccagaattccagagggcgtatgta
ggaaatcttccaagaatatttgactactctcctttagatccaacacaagatttcaacaca
cagatgactaagttaggacacgggcttctctcaggccagtattcgaaacctccggtgaaa
tctgaactcatagaacaggtgatgaaggaggaacacaagcctcagcagaatgggatctct
ccacgcatgtttaaggcctttgtaagcaagagccacccagaattctcctccaatagacag
caggatgcccaggaatttttcttgcacctggtgaatcttgtagagaggaaccgcatcggc
tcagaaaacccaagtgatgtttttcggtttttggtggaagaacgtattcagtgctgtcag
acccggaaagtccgctacacagagcgagtggattacctgatgcagttgcctgtggccatg
gaggcagcgaccaacaaggatgaactgatcgcctatgagttaacgagaagggaagcagaa
gcgaacagaagacccctccccgaggtggttcgtgccaagatcccctttagtgcctgcctt
caggccttttctgaaccggaaaacgttgacgatttctggagtagcgccctccaggcaaag
tctgcgggtgtgaaaacatctcgctttgcctcattccctgaatacttggtagtgcagata
aagaagttcacttttggtcttgactgggttcccaaaaaatttgatgtttctattgatatg
ccagacctacttgacatcaaccatctccgagccagggggttacagccaggagaggaggaa
cttccagacatcagccccccaatagtcattcctgatgactcaaaagatcgcctgatgaac
caattcatagacccatcagacatcgatgagtcatcagtgatgcagctggccgagatgggg
ttccctctagaagcgtgtcggaaggctgtgtactttactggaaatatgggagccgaggtg
gccttcaactggatcattgttcacatggaggagccagattttgctgaaccactgaccatg
cctggttatggaggagcagcttctgctggagcctctgtttttggtgctactggattggat
aaccaacctccggaggaaattgtagctattattacctccatgggattccatcgaaatcag
gctattcaggcgctacgagcaacaaataataacctggaaagagcactggattggatcttt
agccaccctgagtttgaggaggacagtgactttgtgatcgagatggagaataacgccaat
gcaaacattatttctgaggccaagcccgaaggacctagagtcaaggatggatctggaatg
tatgaattatttgcattcatcagtcacatgggaacatctacaatgagtggccattatgtt
tgccatatcaaaaaggaaggaaggtgggtgatctacaatgaccacaaagtttgtgcctct
gaaaggccccctaaagacctgggctacatgtacttttaccgcaggataccaagctaa

DBGET integrated database retrieval system