KEGG   Equus caballus (horse): 100065844Help
Entry
100065844         CDS       T01058                                 

Gene name
USP13
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 13
  KO
K11836  ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100065844 (USP13)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100065844 (USP13)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100065844 (USP13)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100065844 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UBA zf-UBP UCH_1 UBA_4 UBA_3
Motif
Other DBs
NCBI-GeneID: 100065844
NCBI-ProteinID: XP_023479110
Ensembl: ENSECAG00000004152
Position
19
AA seq 863 aa AA seqDB search
MQRRGALFGMPGGSGSRKMAAGDIGELLVPHMPTIRVPRSGDRVYKSECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG
TENGLRDNDIKPRVSEWEVIQETGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPEVVRAKIP
FSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQFIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFG
ATGLDNQPPEEIVAIITSMGFHRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIISEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccggggcgccctgttcggcatgccgggcggcagcggcagcaggaagatggct
gcaggagacatcggcgagctgctggtgccccacatgcccacgatccgcgtgcccaggtcc
ggggaccgggtctacaagagcgagtgcgccttctcctacgactcccccaattctgaaggt
ggactctatgtatgcatgaatacatttttggcctttggaagggaacatgttgaaagacat
tttcgaaaaactggacagagtgtgtacatgcacctgaagagacatgtacgagagaaggta
agaggggcatctggtggagctttaccaaaaaggaggaattcaaagatttttttagatcta
gatactgatgacgatttaaatagcgacgattatgaatatgaagatgaagccaaacttgtt
attttcccagaccactatgaaatagcactaccaaatattgaggagttaccagccctggta
acaattgcttgtgatgcagttctcagctcaaaatctccatacagaaagcaggacccagac
acttgggaaaatgaattgccagtatccaaatatgccaataacctcacccagctggacaat
ggagtcaggattcctccaagtggttggaagtgtgccaggtgtgacctgcgggaaaacctc
tggttaaatctgaccgatggctctgtgctgtgtgggaagtggttctttgacagctctggg
ggcaacgggcatgcactggagcattacagagacatgggctaccctctagctgtgaagctg
ggaaccatcactcctgatggggcagatgtttattcttttcaagaagaggaacccgttttg
gatcctcatttggccaagcacttagcgcattttggaattgatatgcttcacatgcacggg
acagagaatgggctccgggacaatgacatcaagcctcgtgtcagcgagtgggaagtgatc
caggagacggggacgaagctgaagcccatgtatggccctggatacacgggtctcaagaac
ctggggaacagctgctatctcagttctgtcatgcaggccatcttcagcatcccagaattc
cagagggcgtatgtaggaaatcttccaagaatatttgactactctcctttagatccaaca
caagatttcaacacacagatgactaagttaggacacgggcttctctcaggccagtattcg
aaacctccggtgaaatctgaactcatagaacaggtgatgaaggaggaacacaagcctcag
cagaatgggatctctccacgcatgtttaaggcctttgtaagcaagagccacccagaattc
tcctccaatagacagcaggatgcccaggaatttttcttgcacctggtgaatcttgtagag
aggaaccgcatcggctcagaaaacccaagtgatgtttttcggtttttggtggaagaacgt
attcagtgctgtcagacccggaaagtccgctacacagagcgagtggattacctgatgcag
ttgcctgtggccatggaggcagcgaccaacaaggatgaactgatcgcctatgagttaacg
agaagggaagcagaagcgaacagaagacccctccccgaggtggttcgtgccaagatcccc
tttagtgcctgccttcaggccttttctgaaccggaaaacgttgacgatttctggagtagc
gccctccaggcaaagtctgcgggtgtgaaaacatctcgctttgcctcattccctgaatac
ttggtagtgcagataaagaagttcacttttggtcttgactgggttcccaaaaaatttgat
gtttctattgatatgccagacctacttgacatcaaccatctccgagccagggggttacag
ccaggagaggaggaacttccagacatcagccccccaatagtcattcctgatgactcaaaa
gatcgcctgatgaaccaattcatagacccatcagacatcgatgagtcatcagtgatgcag
ctggccgagatggggttccctctagaagcgtgtcggaaggctgtgtactttactggaaat
atgggagccgaggtggccttcaactggatcattgttcacatggaggagccagattttgct
gaaccactgaccatgcctggttatggaggagcagcttctgctggagcctctgtttttggt
gctactggattggataaccaacctccggaggaaattgtagctattattacctccatggga
ttccatcgaaatcaggctattcaggcgctacgagcaacaaataataacctggaaagagca
ctggattggatctttagccaccctgagtttgaggaggacagtgactttgtgatcgagatg
gagaataacgccaatgcaaacattatttctgaggccaagcccgaaggacctagagtcaag
gatggatctggaatgtatgaattatttgcattcatcagtcacatgggaacatctacaatg
agtggccattatgtttgccatatcaaaaaggaaggaaggtgggtgatctacaatgaccac
aaagtttgtgcctctgaaaggccccctaaagacctgggctacatgtacttttaccgcagg
ataccaagctaa

DBGET integrated database retrieval system