KEGG   Equus caballus (horse): 100066152Help
Entry
100066152         CDS       T01058                                 

Gene name
ENTPD2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2 isoform X1
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100066152 (ENTPD2)
 Organismal Systems
  Sensory system
   04742 Taste transduction
    100066152 (ENTPD2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     100066152 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 100066152
NCBI-ProteinID: XP_023485192
Ensembl: ENSECAG00000016865
Position
25
AA seq 495 aa AA seqDB search
MARKVLSLLLPSLLAAVGLAGLLLLCVPTRDVWEPPSLKYGIVLDAGSSHTSMFIYKWPA
DKKNDTGIVSQHSSCNVHGGGISSYADNPSGAGQSLVECLDQALRDVPKDRHRGTPLYLG
ATAGMRLLNLTRPEAATNVLAAVTRTLTQYPFHFRGARILSGQDEGVFGWVTANYLLEKF
IKYGWVGQWFQPRKGTLGAMDLGGASTQITFETASPAEDPANEVQLRLYGQHYRVYTHSF
LCYGRDQVLQRLLAGALQTHGPHPCWPRGYSAQVQLQDVYDSPCTAAQGPLTFNSSASIS
LSGSSEPALCRSLVSQLFNFSSCHFSQCSFNGVFQPPVTGSFIAFSAFFYTMDFLRTVMG
LPVATLQQLEAAATTLCSQTWSELQARAPGERAHLPNYCAGATFMQQLLSRGYGFDERAF
SGVTFQKKAGDTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFAAVLLAALV
LLLRQARSAKSPGAI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaggtcctgtcgctgctgctgccgtcgttgctggccgcggtgggcctcgcc
ggcctcctgctgctgtgcgtccccacccgcgacgtctgggagccgccctccctcaagtat
gggattgttctggacgctggttcttcccacacgtccatgttcatctacaagtggccggcg
gacaagaagaatgacacaggcatcgtgagccagcacagctcctgtaacgtgcacggtggg
ggcatctccagctatgcagacaacccttccggggctgggcagagtcttgtcgaatgcctg
gaccaggcgcttcgggacgtgcccaaggacagacacaggggcacgcccctctacctggga
gccacggcaggcatgcgcctgctcaacctgacccgtccagaggccgcgaccaacgtgctt
gcagctgtgacccggacactgacgcagtacccttttcacttccgtggggcccgcatcctc
tcgggccaggacgagggggtgtttggctgggtgactgccaactacctgctggagaagttc
atcaagtatggctgggtgggccagtggttccagccaaggaaggggacgctgggggccatg
gacctggggggcgcgtccacacagatcacctttgagacagccagcccagctgaggaccca
gccaatgaggtccagctgcggctctacggccagcactaccgcgtctacacccacagcttc
ctctgctatggccgtgaccaggtcctccagaggctgctggctggagccctccagacccat
ggcccccacccctgctggccgaggggctactctgcccaagtgcagctccaggatgtgtat
gattcgccgtgcacggcagcccagggacccctgaccttcaacagcagtgccagcatcagc
ctgtcgggcagcagcgagccggccctctgccgcagccttgtctcgcagctcttcaacttc
tcctcctgccacttctctcagtgctccttcaatggcgtcttccagccccctgtgacaggg
agcttcatcgccttctccgctttcttctacactatggacttcctgaggaccgtgatgggg
ctgcctgtggccaccctgcagcagctggaggcggctgccaccactctctgcagccagacg
tggagtgagctgcaggctcgggcgcccggcgagcgggcccacctgcccaactactgcgct
ggggccacgttcatgcagcagctgctgagccgaggctacggcttcgacgagcgcgccttc
agcggggtgaccttccagaagaaggccggagacaccgcggtcggctgggcgctcggctat
atgttgaacctgaccaacctgatccccgccgacccgccgggcttgcgcaagggcacagac
ttcagctcctgggtcgtcctcctcctgctcttcgccgccgtgctcctggccgcgctcgtc
ctgctgctgcgccaggcgcgctccgccaagtcgccgggcgccatctag

DBGET integrated database retrieval system