KEGG   Equus caballus (horse): 100066216Help
Entry
100066216         CDS       T01058                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E isoform X1
  KO
K03259  translation initiation factor 4E
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb03013  RNA transport
ecb04066  HIF-1 signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04211  Longevity regulating pathway
ecb04910  Insulin signaling pathway
Module
ecb_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100066216 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100066216 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100066216 (EIF4E)
   04150 mTOR signaling pathway
    100066216 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100066216 (EIF4E)
  Aging
   04211 Longevity regulating pathway - mammal
    100066216 (EIF4E)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100066216 (EIF4E)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100066216 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100066216 (EIF4E)
Translation factors [BR:ecb03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100066216 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100066216
NCBI-ProteinID: XP_023493442
Ensembl: ENSECAG00000006472
Position
3
AA seq 217 aa AA seqDB search
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccacctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacatcctttacaa
aacagatgggcactctggtttttcaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaaagaggaggacgatggctaattacattgaacaaacag
cagagacgaagtgacctggatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgaatgtgaaaacagagatgctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system