KEGG   Equus caballus (horse): 100066216Help
Entry
100066216         CDS       T01058                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
ecb  Equus caballus (horse)
Pathway
EGFR tyrosine kinase inhibitor resistance
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100066216 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100066216 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100066216 (EIF4E)
   04150 mTOR signaling pathway
    100066216 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100066216 (EIF4E)
  Aging
   04211 Longevity regulating pathway - mammal
    100066216 (EIF4E)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100066216 (EIF4E)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100066216 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100066216 (EIF4E)
Translation factors [BR:ecb03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100066216 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 234 aa AA seqDB search
MPGSKCDSSYPVEAQRLKTTLQHETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRW
ALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWE
DEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKI
AIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcagtaagtgcgacagcagctacccagtggaagcgcagagactgaaaaccacc
ctgcagcacgaaaccacccctactcctaatcccccacctacagaagaagagaaaacagaa
tctaatcaggaggttgctaacccagaacactatattaaacatcctttacaaaacagatgg
gcactctggtttttcaaaaatgataaaagcaaaacttggcaagcaaaccttcggctgatc
tctaagtttgatactgttgaagacttttgggctctgtacaaccatatccagttgtctagt
aatttaatgcctggctgtgactactcactttttaaggatggtattgagcctatgtgggaa
gatgagaaaaacaaaagaggaggacgatggctaattacattgaacaaacagcagagacga
agtgacctggatcgcttttggctagagacactgctgtgccttattggagaatcttttgat
gactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggtgataagata
gcaatatggactactgaatgtgaaaacagagatgctgttacacatatagggagggtatac
aaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccatgcagacaca
gctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system