KEGG   Equus caballus (horse): 100066248Help
Entry
100066248         CDS       T01058                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04520  Adherens junction
ecb04910  Insulin signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04923  Regulation of lipolysis in adipocytes
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb04960  Aldosterone-regulated sodium reabsorption
Module
ecb_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100066248 (INSR)
   04015 Rap1 signaling pathway
    100066248 (INSR)
   04010 MAPK signaling pathway
    100066248 (INSR)
   04066 HIF-1 signaling pathway
    100066248 (INSR)
   04068 FoxO signaling pathway
    100066248 (INSR)
   04072 Phospholipase D signaling pathway
    100066248 (INSR)
   04022 cGMP - PKG signaling pathway
    100066248 (INSR)
   04151 PI3K-Akt signaling pathway
    100066248 (INSR)
   04152 AMPK signaling pathway
    100066248 (INSR)
   04150 mTOR signaling pathway
    100066248 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100066248 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100066248 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100066248 (INSR)
   04913 Ovarian Steroidogenesis
    100066248 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100066248 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    100066248 (INSR)
   04213 Longevity regulating pathway - multiple species
    100066248 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100066248 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100066248 (INSR)
   04931 Insulin resistance
    100066248 (INSR)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100066248 (INSR)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100066248 (INSR)
CD molecules [BR:ecb04090]
 Proteins
  100066248 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 MVL
Motif
Other DBs
NCBI-GeneID: 100066248
NCBI-ProteinID: XP_023500375
Ensembl: ENSECAG00000010127
Position
7
AA seq 1397 aa AA seqDB search
MGAGGRRGAAAAPLLVAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTADGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLTFSHIRTSSDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTNATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQEEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKSSSGPGAEDTRPSRKRRALADVGNVTVAVPTVPGF
PNTSSTSTPTSSEERRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLLNVVQECRHTDI
LFHDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDV
FPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASL
RERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENN
PGRPPPTLQEMVQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIY
ETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQV
LKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFH
SEENKAPESEELEMEFEDMENVPLDRSSHSQREEAGGRDAGSSLGLKRNYEEHIPYTHMN
GGKKNGRILTLPRSNPS
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcagggggccggcggggggcggcggccgcgccgctcctggtggccgtggcggcg
ctgctggtgggcgccgcgggccacctgtaccccggagaggtgtgccctggcatggatatc
cggaacaacctcacgaggctgcacgaactggccaactgctccgtcattgaaggacacttg
cagattctgttgatgtttaaaacgaggcctgaggatttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtgtacgggctggagagcctgaag
gacctgttccccaacctcacggtcatccggggctctcgtctcttcttcaactacgcgctg
gtcatcttcgagatggttcacctgaaggagcttggcctctacaacctgatgaacatcacc
cgcggctccgtccgcatagagaagaacaacgagctgtgctacctggccaccattgactgg
tcacgcattctggactcggtggaagataattacattgtgctgaacaaggacgacaatgag
gagtgcggggacatttgtccaggcaccgccaagggcaagaccaactgccccgccactgtc
atcaacggacagtttgttgagcggtgctggacgcacagccattgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgcggacggcctctgctgccacagcgagtgttta
ggcaactgctctgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactatcacttccaagactggcgctgt
gtcaacttcagcttctgccaggacctgcacaacaaatgcaagaactcccgaaggcagggc
tgccatcagtacgtcattcacaataacaagtgcatccctgagtgtccctctgggtacacg
atgaattccagcaacttgatgtgtaccccgtgcctgggtccctgtcccaaggtgtgccac
ctcctggaaggcgagaagaccatcgactcggtgacgtccgcccaggagctccgaggctgc
acggtcatcaacgggagcctgatcatcaacatccgagggggcaacaacctggcagctgag
ctagaggccaaccttggactcattgaagaaatttcagggtatctgaaaatccgccggtcc
tacgctctcgtgtcgctttccttcttccggaagttacgcctaattcggggagagaccttg
gaaatcgggaactactcattctacgccttggacaaccagaacctgaggcagctatgggac
tggagcaagcacaacctcaccatcactcaggggaaactcttcttccactataatcccaaa
ctctgcttgtcggaaattcacaagatggaggaagtttcaggaaccaaagggcgccaggag
aggaacgacatcgccctgaagaccaacggggaccaggcgtcctgtgaaaatgagttactt
acattttctcacattcggacatcttctgacaagatcttgctgaaatgggagccatattgg
ccccccgacttccgagacctcttgggcttcatgctcttctataaagaggccccttatcag
aacgtgacggagtttgatgggcaggatgcctgtggctccaacagctggacggtagtggac
attgacccacctctgaggtccaacgaccccaagtcacagaaccaccccgggtggctgatg
cgaggtctcaaaccctggacccagtatgccatctttgtcaagaccttggtcaccttttct
gatgaacgccggacatacggggccaagagcgacatcatctatgtccagacaaatgccacg
aacccgtctgtccccctggatcccatctccgtttctaattcctcatcccagattattctg
aagtggaagcccccctctgaccccaatgggaacatcacacactacctggttttctgggag
aggcaggaggaagacagcgagctgtacgagttggattattgcctcaaaggcttgaagctg
ccctccaggacctggtctccaccgtttgagtctgaggggtcccagaagcacaatcagagt
gagtacgaggagtctgccggcgaatgctgctcctgcccgaagaccgactcccagatcctg
aaggagctggaggagtcctcgttcaggaagacgttcgaggactatctgcacaatgtggtt
tttgtccccagaaaatcctcttcaggccctggtgccgaggacactagaccgtctcggaaa
cgcagggcgcttgctgatgtcgggaatgtgacggtggccgtgcccacggttccgggtttc
cctaatacctcctccaccagcacgcccacgagctcagaggagcgcagacccttcgagaaa
gtggtgaacaaggagtcgctggtcatctccggcctgcgccattttaccgggtatcgcatc
gagcttcaggcttgcaaccaagattcccccgaagagaggtgcagtgtggccgcctatgtc
agtgccaggaccatgcctgaagccaaggcggacgacatcgttggccccgtgactcacgaa
atcttcgagaacaatgtcgttcacttgatgtggcaggagcccaaagaacccaacggtctg
atcgtgctgtacgaagtgagttatcggcgatacggcgatgaggagctgcatctctgtgtg
tctcgcagacattttgccctggagcggggctgccggctgcgtgggctgccgccagggaac
tacagtgtgcgagtgcgggccacctccctggcaggcaatggctcctggaccgaagccact
tatttctacgtgacagactatttgctcaatgttgtccaagagtgcagacatacggacatt
ctttttcacgacgtcccatcaaatattgcaaaaatcatcatcggccccctcatctttgtc
tttctcttcagtgtggtcattggaagcatttacctcttcttgagaaagaggcagccagat
gggcccctgggaccgctgtacgcttcctcaaaccctgagtacctcagcgccagtgatgtg
tttccctgctctgtgtacgtgccggacgagtgggaggtgcctcgggagaagatcaccctc
ctgcgggagctggggcagggctccttcggcatggtgtatgaaggcaacgccagggacatc
gtcaagggcgaggcggagacccgcgtggcggtgaagacagtcaacgagtctgccagtctg
cgagagaggatcgagtttctcaacgaggcctcagtcatgaagggcttcacctgccatcac
gtggtccgcctcctgggggtggtatcgaaaggccagccaacgctggtggtgatggagttg
atggctcatggagacctgaagagctacctccgttccctgcggccggaggctgagaataac
cctggccgccctccccctaccctgcaagagatggttcagatggcggcggagatcgccgac
gggatggcgtacctgaacgccaagaagtttgtgcaccgggacctggcagctcgaaactgc
atggtcgcccacgattttaccgtcaaaatcggagactttggaatgaccagagacatctac
gaaacggattactaccggaaaggaggcaaggggctgctccccgtgaggtggatggctcct
gaatccctgaaggacggggtctttactacttcttctgacatgtggtcctttggcgtggtc
ctttgggaaatcaccagcttggcagaacagccttaccaaggcctgtctaatgagcaggtg
ttgaaatttgtcatggatggagggtatctggatcaacccgacaattgtcccgagagagtc
accgacctgatgcgtatgtgctggcagttcaaccccaagatgcggccgaccttcctggag
attgtcgacctgctcaaggatgacctgcaccccagctttccagaagtttccttcttccac
agcgaggagaacaaggcccccgagagcgaggagctggagatggagtttgaggacatggag
aacgtccccctggatcggtcctcacattcccagagggaggaggccgggggccgggatgca
gggtcctcgctgggtctaaagcggaactatgaggaacacatcccgtacactcacatgaac
gggggcaagaaaaatgggcggattctgactctgccgaggtcaaatccttcctaa

DBGET integrated database retrieval system