KEGG   Equus caballus (horse): 100066422Help
Entry
100066422         CDS       T01058                                 

Gene name
CYP2E1
Definition
cytochrome P450, family 2, subfamily E, polypeptide 1 (EC:1.14.14.1)
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100066422 (CYP2E1)
   00590 Arachidonic acid metabolism
    100066422 (CYP2E1)
   00591 Linoleic acid metabolism
    100066422 (CYP2E1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100066422 (CYP2E1)
   00982 Drug metabolism - cytochrome P450
    100066422 (CYP2E1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100066422 (CYP2E1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100066422 (CYP2E1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     100066422 (CYP2E1)
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100066422 (CYP2E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 493 aa AA seqDB search
MAALGITVALLVWVATLLPISIWKQIYSSWNLPPGPFPLPIIGNLFHLDLKNIPKSFTRL
AERYGPVFTLYLGSQRVVVMHGYKAVKEVLLNYKNELSGRGEIAVFQAHKDNGVIFNNGP
SWKDTRRLSLTILRDYGMGKQRNEERIQRETHFLLEALRKTQGQPFDPTFVLGGGPFNVI
ADILFHKHFDYEDKTCQRLMHLFNENFYLLSTPWLQAYNYFSTYLRYLPGSHRKVMKNVS
EIKEFTSERVKEHHKSLDPNCPRDFTDNLLMEMEKEKHSAEPLFTLENITVTTADMFFAG
TETTSTTLRYGLLILLKHPEVEEKLHKEIDSVIGPSRIPAFKDRLEMPYMDAVVHEIQRF
INLVPSNLPHVATQDTAFRGYVIPKGTVVIPTLDSLLYDNQEFPDAEKFKPEHFLNEDGK
FKYSDHFKAFSAGKRVCVGEGLARMELFLFLTAILQHFNLKSLVDPKDIDLSPVTIGFGN
IPPNYKLCIIPRS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctgggcatcacggtggccctgctggtgtgggtggccaccctgctgcccatc
tccatctggaagcagatctacagcagctggaacctgccccctggtcctttcccactgccc
atcattgggaatcttttccacttggacctcaagaatattcccaagtccttcaccaggctg
gcagagcggtacgggccggtgttcaccctgtacctgggctcgcagcgcgtcgtggtcatg
catggctacaaggccgtgaaggaggtcctgctcaactacaagaatgagttgtccggcagg
ggagaaatcgccgtgttccaggcgcacaaggacaatggagttattttcaataatggacca
agctggaaggacacccggcggctctccctgactatcctccgagactatgggatggggaag
cagcgcaacgaggagcggatccagagggaaacccacttcctgctggaggccctcaggaag
acccagggccagcccttcgaccccacctttgtccttggcggcgggcccttcaacgtcatc
gccgacatcctcttccacaagcactttgactacgaggacaagacgtgtcagaggctgatg
cacttgttcaacgagaacttctacttgctcagcaccccctggctccaggcttataattat
ttttcaacctatctgcgctacctgcctggaagccatagaaaagtaatgaaaaatgtgtct
gaaattaaagagtttacttcagaaagagtgaaggagcaccataagtcactggaccccaac
tgcccccgagacttcaccgacaacctgctcatggaaatggagaaggagaaacacagtgcg
gagcccctgtttacgttggaaaacatcactgtgaccacggctgacatgttctttgcaggg
acagagaccaccagcaccacgctgagatacgggctcctgattctcttgaaacacccggag
gttgaagagaaacttcataaagagattgacagtgtgattgggccaagccgaatccctgcc
ttcaaggacagactagagatgccctacatggatgctgtggtgcatgagattcagcgattc
atcaacctcgtgccctccaacctgccccatgtagcaacccaggacacagcgttcagagga
tatgtcatccctaagggcacagtcgtaattccgacactggattcactcttgtatgacaac
caagagttccctgatgcagagaagtttaagccagagcactttctgaacgaagacggaaag
ttcaagtacagcgaccatttcaaggcattttccgcaggaaagcgcgtgtgcgtcggagaa
ggcctggctcgcatggagctgtttctgttcctgactgccattctgcagcactttaacttg
aagtctctggttgaccccaaggatattgacctcagccccgtcacgattgggtttggcaac
atcccacccaattacaagctctgcatcattccccgctcgtga

DBGET integrated database retrieval system