KEGG   Equus caballus (horse): 100066748Help
Entry
100066748         CDS       T01058                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb00071  Fatty acid degradation
ecb00280  Valine, leucine and isoleucine degradation
ecb00310  Lysine degradation
ecb00380  Tryptophan metabolism
ecb00410  beta-Alanine metabolism
ecb00640  Propanoate metabolism
ecb00650  Butanoate metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01212  Fatty acid metabolism
Module
ecb_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
ecb_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ecb_M00085  Fatty acid biosynthesis, elongation, mitochondria
ecb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100066748 (ECHS1)
   00650 Butanoate metabolism
    100066748 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100066748 (ECHS1)
   00071 Fatty acid degradation
    100066748 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100066748 (ECHS1)
   00310 Lysine degradation
    100066748 (ECHS1)
   00380 Tryptophan metabolism
    100066748 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100066748 (ECHS1)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100066748 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100066748
NCBI-ProteinID: XP_023492168
Ensembl: ENSECAG00000012703
Position
1
AA seq 290 aa AA seqDB search
MAALRALLSWVRAPLLLRPGWPAPRRFASGTNFEYIIAEKKGKNSTVGLIRLNRPKALNA
LCNGLIVELNQALEAFEKDPAVGAIVLTGGEKAFAAGADIKEMQNHTFQDCYSSKFLSHW
DQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMILTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIASNSKIVAAMA
KESVNAAFEMTLTEGNKLEKKLFYSTFATEDRKEGMAAFVEKRKATFRDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctacgcgcgctgctgtcctgggtccgtgcgccgctgctcctccggcccggc
tggcccgcgccgcgccgcttcgcctcgggcactaactttgagtacatcatcgcagagaag
aaggggaagaacagcactgtggggctgatccgactgaaccgccccaaggcgctcaatgca
ctctgcaatggcctcatagtcgagctcaaccaggcgctggaggccttcgagaaggacccg
gctgtgggggccattgtcctcacaggcggggagaaggcatttgcagctggagctgatatc
aaggaaatgcagaaccacacgttccaggactgttactccagcaagttcttgagccactgg
gaccaactcacccgggtcaagaagccagtcatagctgctgtcaatggttatgctcttggt
ggcggctgtgaacttgccatgatgtgtgacatcatttatgcaggagagaaagcccagttt
gggcagccagaaatcctgataggaaccatcccaggtgcagggggtacccagagactgacc
cgcgccgtcggaaagtccttggccatggagatgattctcaccggcgaccggatctcagcc
caggatgccaagcaagcaggtcttgtcagcaaaattttccctgttgagacactggtcgaa
gaagccatccagtgcgcagaaaaaattgccagcaattctaaaattgtcgcagcgatggcc
aaagagtcagtgaatgccgctttcgagatgacattaacagagggaaataagctggagaag
aaactcttctattcaacttttgctactgaggaccggaaggaagggatggcggcgttcgtg
gagaagcggaaggccaccttcagagaccagtga

DBGET integrated database retrieval system