KEGG   Equus caballus (horse): 100066748Help
Entry
100066748         CDS       T01058                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100066748 (ECHS1)
   01212 Fatty acid metabolism
    100066748 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100066748 (ECHS1)
   00650 Butanoate metabolism
    100066748 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100066748 (ECHS1)
   00071 Fatty acid degradation
    100066748 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100066748 (ECHS1)
   00310 Lysine degradation
    100066748 (ECHS1)
   00380 Tryptophan metabolism
    100066748 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100066748 (ECHS1)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100066748 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 312 aa AA seqDB search
MKAESRTKATRVAESCMPQPPRTEQESLSPQRGTSPRLDAYINGNPFSFSLGTNFEYIIA
EKKGKNSTVGLIRLNRPKALNALCNGLIVELNQALEAFEKDPAVGAIVLTGGEKAFAAGA
DIKEMQNHTFQDCYSSKFLSHWDQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKA
QFGQPEILIGTIPGAGGTQRLTRAVGKSLAMEMILTGDRISAQDAKQAGLVSKIFPVETL
VEEAIQCAEKIASNSKIVAAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATEDRKEGMAA
FVEKRKATFRDQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagagagtcgtacaaaggccacccgtgtggctgaaagctgcatgccgcagcca
ccaagaactgagcaggagtcactgtcccctcagaggggtacgtccccccggttagatgcc
tacataaatggaaatcctttttccttctccctaggcactaactttgagtacatcatcgca
gagaagaaggggaagaacagcactgtggggctgatccgactgaaccgccccaaggcgctc
aatgcactctgcaatggcctcatagtcgagctcaaccaggcgctggaggccttcgagaag
gacccggctgtgggggccattgtcctcacaggcggggagaaggcatttgcagctggagct
gatatcaaggaaatgcagaaccacacgttccaggactgttactccagcaagttcttgagc
cactgggaccaactcacccgggtcaagaagccagtcatagctgctgtcaatggttatgct
cttggtggcggctgtgaacttgccatgatgtgtgacatcatttatgcaggagagaaagcc
cagtttgggcagccagaaatcctgataggaaccatcccaggtgcagggggtacccagaga
ctgacccgcgccgtcggaaagtccttggccatggagatgattctcaccggcgaccggatc
tcagcccaggatgccaagcaagcaggtcttgtcagcaaaattttccctgttgagacactg
gtcgaagaagccatccagtgcgcagaaaaaattgccagcaattctaaaattgtcgcagcg
atggccaaagagtcagtgaatgccgctttcgagatgacattaacagagggaaataagctg
gagaagaaactcttctattcaacttttgctactgaggaccggaaggaagggatggcggcg
ttcgtggagaagcggaaggccaccttcagagaccagtga

DBGET integrated database retrieval system