KEGG   Equus caballus (horse): 100066762Help
Entry
100066762         CDS       T01058                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100066762 (USP30)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100066762 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 496 aa AA seqDB search
MAGMAAEYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNS
LLQGLSACPAFIRWLEEFTSQYARDQMEPPPHQYLSLTLLHLLKALSCQEVTDDEVLDAS
CLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEATPK
QITCRTRGSLHPTFTHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWG
HPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCL
CIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPGQRGPKLKENPGPVVELQ
DGPAAPRSVLNQPGGPKTQIFMNGACSPSLLPTLPTPMPFPLPVVPDYSSSSYLFRLMAV
VVHHGDMHSGHFVTYRRSPPSAKNPLSTSSQWLWISDDSVRKASLQEVLSSSAYLLFYER
VLSRTQQQSPEYKSEE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggctgggatggcggcagaatataaagtcatgaagaactggggtgttataggtggaatt
gcggctgctcttgcagcaggaatatatgttatttggggtcccattacggaaagaaagaag
cgtagaaaagggctggtgcctggcctcgtcaacctcgggaacacctgcttcatgaactcc
ctgctgcagggcctgtcggcctgccccgccttcatcaggtggctggaggagttcaccagc
cagtacgccagggatcagatggagcccccgccgcaccagtatctctcgctcacactgctg
cacctcctgaaagctttatcctgccaagaagttactgatgatgaggtcttggatgcaagc
tgcttgctggatgtcttaagaatgtacagatggcagatctcttcatttgaagagcaggat
gctcatgagttattccacgtcattacctcgtcattggaggatgagcgggaccgccagccc
cgggtcacacatttgtttgatgttcactccctggagcagcagtcagaagcaactcccaag
cagataacctgccgcacaagagggtcactgcatcccacgttcactcactggaagtctcag
catcctttccacgggagacttactagtaatatggtctgcaagcactgtgaacaccagagt
cctgttcgatttgatacctttgatagcctttcgctaagtattccagctgccacgtggggt
catccattgaccctggaccactgccttcaccacttcatctcatcagaatcagtgcgagat
gttgtatgtgacaactgtacgaagatcgaagccaaagggacgttgaacggggagaaggtg
gagcaccagaggaccacttttgttaaacagttaaagctggggaagctccctcagtgcttg
tgcatccacctccagcggctgagctggtccagccacggcacgcccctgaagcggcacgag
cacgtgcagtttaatgagttcctgatgatggacatctacaagtaccacctcctcggacat
aaacctggtcagcgtggcccgaaactgaaggagaacccggggcctgtggtggaactgcag
gacgggccggcagcccccagatcagttctgaatcagcctgggggccccaaaacacaaatt
tttatgaatggcgcctgctccccgtctttactgcctacgctgccaaccccgatgcccttc
cccctcccagttgttcctgactacagctcctcctcgtacctcttccggctgatggcagtt
gtcgtccaccatggagacatgcactctggacactttgtgacttaccgacggtccccacct
tccgccaagaaccctctctccaccagcagccagtggctgtggatttctgatgacagcgtg
cgcaaggcgagcctgcaggaggtcctgtcctccagcgcctacctgctgttctacgagcgt
gttctgtccaggacgcagcagcagagtccggagtacaagtctgaggagtga

DBGET integrated database retrieval system