KEGG   Equus caballus (horse): 100067109Help
Entry
100067109         CDS       T01058                                 

Gene name
CYP3A95
Definition
cytochrome p450 3A95
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100067109 (CYP3A95)
   00591 Linoleic acid metabolism
    100067109 (CYP3A95)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100067109 (CYP3A95)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100067109 (CYP3A95)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100067109 (CYP3A95)
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP3 family
   100067109 (CYP3A95)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 503 aa AA seqDB search
MDLIPSLSMETWVLLATSLVLLYLYGTYSHGHFKKLGIPGPTPLPFFGTVLGYIKGVLAF
DKKCFKKYGKMWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRSFGPMGLMKNAITI
AEDEKWKRIRTLLSPTFTSGKLKEMFPIIGQYGDMLVRNLRKEAEKGKPITMKDIFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSILFFPFLIPVYEALNIFL
FPKCVTDFFIKSVKKMKESRLKDKAKQRVDFLQLMINSQNSKEIDNLKVLSDLELVAQSI
TFIFAGYEPVSTSLSFLLYLLATHPDVQQKLQEEIDATFPNKAPPTYDALVQMEYLDMVL
NETLRLFPIADRLERVCKKDVEINGVFIPKGSTVMMPIFVLHQHPEFWSEPEEFRPERFS
KKNKDSINPYTYLPFGTGPRNCIGMRFAIVNIKLAVVRVLQNFSFKPCKETQIPLKLVSQ
GLIRPEKPIVLKVESRDGTMSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacctgatcccaagcctttccatggaaacgtgggttctcctagctaccagtctagtg
ctcctctatctgtatgggacctattcacatggacattttaagaaactgggaattcctggg
ccaacacctctgccattttttggaactgttctgggctacattaagggtgttttggctttt
gacaagaaatgttttaagaaatatggaaaaatgtgggggttttatgatggtcgacagccc
gtgttggctatcacagatccagacatgatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggcggtcttttggtccaatgggacttatgaaaaatgccatcactata
gctgaggatgaaaaatggaagagaatacgaacattactgtctccaaccttcaccagtggg
aagctcaaggagatgttccctatcattggccagtatggagatatgttggtgaggaacctg
aggaaggaagcagagaaaggcaaacccatcaccatgaaagacatctttggggcctacagc
atggatgtgattactagcacatcatttggagtgaacatagattccctcaataacccacaa
gatccttttgtggaaaatactaagaagctcttaagatttgatttccttgatccattcttc
ctctcaatactattctttccatttcttatcccagtttatgaagcattaaatatctttctt
tttccaaaatgtgttactgatttcttcataaaatctgtaaaaaagatgaaagaaagtcgt
ctcaaagataaagcaaagcaacgagtggattttcttcagctaatgattaactcccaaaat
tccaaagaaatagacaaccttaaagttctgtctgatctagaacttgtggcccaatctatt
acgtttatctttgctggctatgagcctgttagcacttctctttccttccttctgtatctt
ttggccactcaccctgatgtccagcagaagctacaggaggagattgatgcgactttcccc
aataaggcacctcctacctatgatgccctggtacagatggaatatcttgatatggtgttg
aatgaaactctcagattattcccaattgctgatagacttgagagggtctgtaagaaagat
gtggaaatcaatggggtgttcattcccaaagggtcaacagtgatgatgccaatctttgtt
cttcaccaacacccagagttctggtcggaacctgaggagttccgtcctgaaagattcagt
aagaagaacaaggacagcataaatccttatacatacctgccctttggaactggaccccga
aactgcattggcatgaggttcgctatcgtaaacataaaacttgcggttgtcagagtgctg
cagaacttctccttcaaaccttgtaaagaaacgcagattccccttaaattagtcagtcaa
ggacttattcgaccggaaaaacccattgttctgaaagttgagtcgagagatgggaccatg
agtggagcctga

DBGET integrated database retrieval system