KEGG   Equus caballus (horse): 100067109Help
Entry
100067109         CDS       T01058                                 

Gene name
CYP3A95
Definition
cytochrome p450 3A95
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ecb00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ecb00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ecb00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ecb05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 503 aa AA seqDB search
MDLIPSLSMETWVLLATSLVLLYLYGTYSHGHFKKLGIPGPTPLPFFGTVLGYIKGVLAF
DKKCFKKYGKMWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRSFGPMGLMKNAITI
AEDEKWKRIRTLLSPTFTSGKLKEMFPIIGQYGDMLVRNLRKEAEKGKPITMKDIFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSILFFPFLIPVYEALNIFL
FPKCVTDFFIKSVKKMKESRLKDKAKQRVDFLQLMINSQNSKEIDNLKVLSDLELVAQSI
TFIFAGYEPVSTSLSFLLYLLATHPDVQQKLQEEIDATFPNKAPPTYDALVQMEYLDMVL
NETLRLFPIADRLERVCKKDVEINGVFIPKGSTVMMPIFVLHQHPEFWSEPEEFRPERFS
KKNKDSINPYTYLPFGTGPRNCIGMRFAIVNIKLAVVRVLQNFSFKPCKETQIPLKLVSQ
GLIRPEKPIVLKVESRDGTMSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacctgatcccaagcctttccatggaaacgtgggttctcctagctaccagtctagtg
ctcctctatctgtatgggacctattcacatggacattttaagaaactgggaattcctggg
ccaacacctctgccattttttggaactgttctgggctacattaagggtgttttggctttt
gacaagaaatgttttaagaaatatggaaaaatgtgggggttttatgatggtcgacagccc
gtgttggctatcacagatccagacatgatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggcggtcttttggtccaatgggacttatgaaaaatgccatcactata
gctgaggatgaaaaatggaagagaatacgaacattactgtctccaaccttcaccagtggg
aagctcaaggagatgttccctatcattggccagtatggagatatgttggtgaggaacctg
aggaaggaagcagagaaaggcaaacccatcaccatgaaagacatctttggggcctacagc
atggatgtgattactagcacatcatttggagtgaacatagattccctcaataacccacaa
gatccttttgtggaaaatactaagaagctcttaagatttgatttccttgatccattcttc
ctctcaatactattctttccatttcttatcccagtttatgaagcattaaatatctttctt
tttccaaaatgtgttactgatttcttcataaaatctgtaaaaaagatgaaagaaagtcgt
ctcaaagataaagcaaagcaacgagtggattttcttcagctaatgattaactcccaaaat
tccaaagaaatagacaaccttaaagttctgtctgatctagaacttgtggcccaatctatt
acgtttatctttgctggctatgagcctgttagcacttctctttccttccttctgtatctt
ttggccactcaccctgatgtccagcagaagctacaggaggagattgatgcgactttcccc
aataaggcacctcctacctatgatgccctggtacagatggaatatcttgatatggtgttg
aatgaaactctcagattattcccaattgctgatagacttgagagggtctgtaagaaagat
gtggaaatcaatggggtgttcattcccaaagggtcaacagtgatgatgccaatctttgtt
cttcaccaacacccagagttctggtcggaacctgaggagttccgtcctgaaagattcagt
aagaagaacaaggacagcataaatccttatacatacctgccctttggaactggaccccga
aactgcattggcatgaggttcgctatcgtaaacataaaacttgcggttgtcagagtgctg
cagaacttctccttcaaaccttgtaaagaaacgcagattccccttaaattagtcagtcaa
ggacttattcgaccggaaaaacccattgttctgaaagttgagtcgagagatgggaccatg
agtggagcctga

DBGET integrated database retrieval system