KEGG   Equus caballus (horse): 100067118Help
Entry
100067118         CDS       T01058                                 

Gene name
ST3GAL5
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
ecb  Equus caballus (horse)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ecb00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 389 aa AA seqDB search
MPSEYNCVKLRSDCSRPSLQWYTRAQNKMRRPNLLLKDILKCTLLVFGVWILYILKLNYA
TEECDMKKMPYVDPDRVKRAQKYAQQVLQEECRPKFAKQSMARLFEHRYSTDLPPFVQKA
PQGNDAEYRYDPPFGFRKFSSKVQTLLEILPEHDFPEHLKAKSCRRCVVIGSGGILHGLE
LGRALNQFDVVIRLNNAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKS
VDFNWLQAVVKNETLPFWVQLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQ
SRFWGRDKNVPTIGIIAVVLATHLCDEVSLAGFGYDLSEPKRPLHYFDNLCMSAMNFQTM
HNVTTETTFLLKLVKEGVVRDLSGGINPL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtgagtataactgtgtgaaactgagaagcgattgctcaagaccctccctgcaa
tggtacacccgagctcaaaacaagatgagaagacccaacttgttattaaaagacatcctc
aagtgtacgttgcttgtgtttggagtgtggatcctgtatatcctcaagttaaattatgct
actgaagaatgtgacatgaaaaaaatgccttatgtggaccctgaccgtgtaaagagagct
cagaaatatgctcagcaagtcttgcaagaggagtgccggcccaaatttgcaaagcagtcg
atggcgcggttgtttgagcacaggtacagcacggacttaccgcctttcgtgcagaaggct
ccccaggggaatgacgccgagtaccggtatgatcctccctttggcttccggaagttctcc
agtaaagtccagaccctcttggaaatactgcctgagcacgacttccctgaacacttgaaa
gcgaagagttgtaggcggtgtgtggttattggaagcggcgggatactccacgggctagaa
ctgggccgagccctgaaccagttcgatgttgtgatcaggttaaacaatgcaccagttgaa
gggtattcagagcatgttggaaataaaactactataaggatgacttatccagagggtgcg
ccactgtccgaccttgaatattattccaatgacctgtttgttgctgttttatttaagagt
gttgacttcaactggcttcaagcagtggtaaaaaatgaaactctgccattctgggtgcaa
ctcttcttttggaagcaggtggcggaaaaaatcccactacagccaaaacatttcaggatc
ttgaatccagttattatcaaagagactgcctttgacatccttcaatactcagagcctcag
tcgaggttctggggccgagataagaacgtccccaccattggcatcattgctgttgtcttg
gccacacatctgtgcgatgaagtcagtttggcaggctttggatatgacctcagtgaaccc
aaaagacctttgcattactttgacaacctctgcatgtctgccatgaactttcagaccatg
cataatgtgacgacggagaccacgttccttctcaagctggtcaaagagggcgtggtgcgg
gatctcagcgggggcatcaatccattgtga

DBGET integrated database retrieval system