KEGG   Equus caballus (horse): 100067159Help
Entry
100067159         CDS       T01058                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3 (EC:3.4.19.12)
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 520 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQTPLTNHKKSEKQDKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSSLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSPSNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRNKRSKNQENGP
VCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPENCLYDLAAVVVHHGSGVGSGHYTAYATHEG
RWFHFNDSTVTLTDEDTVVKAKAYILFYVERQAKAGSDKL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccgcacctcagctccagcgtctgcatcgctccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgccggtccaacaaaagcccctgggtc
tgtttgacttgttcgagtgtccactgtggaaggtatgtgaatggccatgcaaaaaaacat
tatgaagatgcacaaacacccttaaccaaccataagaaatcagaaaagcaagataaagct
cagcacacagtgtgtatggattgcagtagctacagtacatactgttatcgctgtgatgat
tttgtggttaatgacaccaagctgggactggtacagaaagtcagagaacacttacagaac
ttggaaaactcagctttcacagctgacaggcataggaaaagaaaactcttggaaaactca
tcactaaacagcaaattattaaaagtaaatggaagcaccactgccatttgtgccacgggc
cttcggaatttggggaacacatgtttcatgaatgctattcttcagtcactcagtaacatt
gagcagttttgctgttatttcaaagaactgcccgctgtggaattaaggaatgggaaaaca
gcaggaagacgaacataccacaccaggagccaaggggataacaatgtgtctttggtggaa
gagtttagaaaaacactctgtgctttatggcaaggtagccagactgcatttagcccagag
tccttattttatgttgtttggaagattatgccgaattttaggggttatcagcagcaggat
gcccacgaattcatgcgctaccttttggaccacctgcacttggagctccagggcggtttc
aacggtgtttcccgctcagcaattctgcaggagaattctactctgtctccaagtaacaaa
tgttgcataaatggagcatctacggttgtcacggctatattcggaggcattctccaaaat
gaggttaattgcctcatatgtgggacagaatctagaaagtttgatccattcctagacctt
tcattagatattccaagtcagttcagaaataagcgctctaagaatcaagaaaatggacca
gtttgttcattacgagattgtcttcgaagttttaccgacttagaagaacttgatgagaca
gagttatatatgtgccacaaatgcaaaaagaaacaaaagtccactaaaaagttttggatt
caaaaactacccaaggtgctatgcttacatttgaaaaggtttcactggacagcctattta
agaaacaaagttgatacatatgtagaatttccactgagaggcctagacatgaaatgctac
ttactagagcctgagaacagcggcccggagaactgcctgtacgacctcgctgccgtggtg
gtgcaccatggttccggggtcggttctggacattacacagcatatgcaactcacgaaggt
cgctggttccatttcaatgacagtactgtaacactgactgatgaagacaccgttgtgaag
gcaaaggcctacatcctgttttatgtggaacgtcaggccaaagctggatccgataaactt
taa

DBGET integrated database retrieval system