KEGG   Equus caballus (horse): 100067242Help
Entry
100067242         CDS       T01058                                 

Gene name
ART4
Definition
(RefSeq) ecto-ADP-ribosyltransferase 4
  KO
K06717  ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100067242 (ART4)
CD molecules [BR:ecb04090]
 Proteins
  100067242 (ART4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
 Enzymes
  100067242 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ART
Motif
Other DBs
NCBI-GeneID: 100067242
NCBI-ProteinID: XP_001497391
Ensembl: ENSECAG00000009217
UniProt: F6WLC5
Position
6
AA seq 325 aa AA seqDB search
MKLQERRSTFNTSKGCPLTNRCRRILLPTSAAPAMGIWLLRGQLLLLLLSGLQRPTGSSE
VAIKIDFDLAPGSFDDQYQGCSQEVMEALNQGDYFTKELKASRNYFNVWQKAHLTLLNQE
KALPKNMNITHAVAVLLYSSNDNIRSDFARAMASAAMSPEQYEHSFCFKYLHYYLTTAIQ
LLREDIVRKNDSLCYEVHHEVKNVSWKAYTGAIIRFGQFLSTSLLREEAQKFGNETLFTI
FTCLGAPLQDFSLKKVLVPPYELFKVVNMSYHPRGNWLQLRSTGNQSTYNCQLLKDSSIK
CIPAPVVIASLSFLTSIFISSKYRA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaagagcgaagaagtacttttaacacaagcaaaggctgtccattgaccaac
agatgcaggaggattcttctcccaacttctgcggcccctgccatgggaatctggctcctt
agagggcagcttctcctgctgctgttgtctggcctgcagagacccacggggagttctgag
gttgcaattaaaatcgactttgatttggcaccaggttcctttgatgatcagtaccaaggc
tgcagccaagaggtcatggaggcactaaatcaaggagattatttcacaaaagaactaaaa
gccagtaggaattatttcaatgtctggcagaaagcccacttaaccttgctgaatcaagaa
aaagctctccccaagaacatgaatatcacacacgctgtggctgttttgctttattcatca
aacgacaacattcgctcggactttgctagagccatggccagtgctgctatgtctccagag
cagtatgaacattcattctgtttcaaatatctacactactacctgaccactgcaatccag
ctgctgagggaagacattgtcaggaagaatgactctctgtgttatgaggtgcatcatgag
gtgaagaatgtctcctggaaagcctacacaggcgccattattcgatttggccaattcctc
tccacctcccttctaagagaagaggcacagaagtttgggaacgaaactctgtttaccata
tttacctgcctgggtgcacctctacaagacttctctctcaagaaggtcctggtccctccc
tatgagttgtttaaagttgtaaatatgagctaccacccaagaggaaattggttgcagttg
cggtcaactgggaaccagagcacatataactgtcagctactaaaagattccagcataaag
tgcatccccgctcctgtagttattgcttctctctcctttttgaccagcatcttcatctct
tccaaatacagagcataa

DBGET integrated database retrieval system