KEGG   Equus caballus (horse): 100067247Help
Entry
100067247         CDS       T01058                                 

Definition
(RefSeq) cytochrome P450 2J2 isoform X1
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00590  Arachidonic acid metabolism
ecb00591  Linoleic acid metabolism
ecb01100  Metabolic pathways
ecb04726  Serotonergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100067247
   00591 Linoleic acid metabolism
    100067247
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100067247
  Nervous system
   04726 Serotonergic synapse
    100067247
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100067247
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100067247
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100067247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100067247
NCBI-ProteinID: XP_023484458
Ensembl: ENSECAG00000023905
Position
2
AA seq 537 aa AA seqDB search
MLAVAGSLAAVWTLLPPCALLLGAVAFLFCARVLQRRRPKNYPPGPPRLPFVGNLFHLDF
ERAHLALQRLVKKYGNIFSLDFGDVPSVVITGLPLIKEALVHQDPNFVNRPVIPLRERVF
KQNGLIMSNGQVWKEQRRFALTTLRNFGLGKKNLEERIQEEAHHLIQAIEEENGQPFNPH
FKINNAVSNIICSITFGERFEYEDGQFRELLRMLDEVTHLEASLWCQLYNAFPRIMNFLP
GPHQTLFSNWDKLKLFVARVIENHKRDWNPAETRDFIDAYLKEMEKYKGDVTSSFHEENL
IYSTLDLFFAGTETTSTTLRWGLLYLALYPEVQEKVHAEINSVIGPGQQPSTAARTSMPY
TNAVIHEVQRMGNIIPLNVPREVVVDTSLAGYHLPKGTMILTNLTALHRDPAEWATPNTF
NPEHFLENGQFKKRETFLPFSAGKRMCLGEQLAKSELFIFFTSLLQRFTFRPPSDEQLSL
RFRMGLTIAPAGHRICAVPRQEGVAARGESEQEESSEGSGPFSEVREQDEGGSEERS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggtggcgggctccctggcggcggtctggaccctgctgcctccctgcgcgctc
ctgctgggcgccgtggccttcctcttctgtgctcgcgtcctccaaaggcggcgccccaag
aactacccgcccgggcccccgcgcctgcccttcgtcggcaacttgttccatctggacttt
gagcgggcgcacctggcgcttcagcggcttgtgaagaaatacgggaacatttttagcctg
gacttcggtgatgtgccttcagttgttataactggattgcccttaattaaggaagccctt
gtccaccaggacccaaacttcgtgaaccgccctgtaatccctctccgagaacgtgtcttt
aagcaaaatggattgatcatgtccaacggccaggtatggaaggagcaaagaaggtttgcc
ctgacaacgctgaggaactttggtttgggaaagaagaacttggaggaacgcattcaggag
gaggcccaccacctcatccaggcaatagaggaggagaatggacagccttttaaccctcac
ttcaagatcaacaatgcagtttccaatattatttgctccatcacctttggagagcgcttt
gagtacgaggatggtcagtttcgagaactcctgaggatgctggatgaggtcacccatctg
gaggcatcactgtggtgccaactctacaatgcctttccacggataatgaacttccttcct
ggcccccaccaaacactctttagcaactgggacaaactgaaattgtttgttgctcgtgta
attgaaaaccacaaaagagactggaaccctgccgaaacaagagactttattgatgcttac
ctcaaggaaatggaaaagtataagggcgatgtcacttcaagtttccatgaagaaaacctc
atctacagtaccctggacctcttctttgctggaaccgagacgacttcgacaacactgcgc
tggggtctgctctacttggccctctacccagaagtccaagaaaaagtacacgctgaaatc
aacagcgtgataggcccggggcagcagccgagcacagcggctcgcacgtccatgccctac
accaatgccgtcatccacgaggtgcagaggatggggaacatcatccccctgaacgtgccc
agggaggtggtggtcgacaccagcctggccgggtaccacctgcccaaggggaccatgatc
ctgaccaatctcactgcgctgcaccgggaccctgcagagtgggccactcccaacaccttc
aatccagagcacttcctggagaatggacagtttaagaaaagggaaacctttctgcctttc
tcagcaggaaagcgcatgtgccttggagagcagttggccaagtctgagttgttcattttc
tttacgtcccttctgcaaagatttaccttcaggcccccaagcgatgagcagctgagcctg
aggttcagaatgggcctcaccatcgcccccgccggccaccgcatctgtgctgttcctcgg
caggaaggtgttgcagccagaggagaaagtgagcaagaggagtcctctgagggctctggc
cccttctcagaagtgagggagcaggatgaaggcggctccgaggaaagatcatag

DBGET integrated database retrieval system