KEGG   Equus caballus (horse): 100067247Help
Entry
100067247         CDS       T01058                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100067247
   00591 Linoleic acid metabolism
    100067247
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100067247
  Nervous system
   04726 Serotonergic synapse
    100067247
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100067247
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100067247
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100067247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 480 aa AA seqDB search
MGWCSQDSSFLKLVKKYGNIFSLDFGDVPSVVITGLPLIKEALVHQDPNFVNRPVIPLRE
RVFKQNGLIMSNGQVWKEQRRFALTTLRNFGLGKKNLEERIQEEAHHLIQAIEEENGQPF
NPHFKINNAVSNIICSITFGERFEYEDGQFRELLRMLDEVTHLEASLWCQLYNAFPRIMN
FLPGPHQTLFSNWDKLKLFVARVIENHKRDWNPAETRDFIDAYLKEMEKYKGDVTSSFHE
ENLIYSTLDLFFAGTETTSTTLRWGLLYLALYPEVQEKVHAEINSVIGPGQQPSTAARTS
MPYTNAVIHEVQRMGNIIPLNVPREVVVDTSLAGYHLPKGTMILTNLTALHRDPAEWATP
NTFNPEHFLENGQFKKRETFLPFSAGKRMCLGEQLAKSELFIFFTSLLQRFTFRPPSDEQ
LSLRFRMGLTIAPAGHRICAVPRQEGVAARGESEQEESSEGSGPFSEVREQDEGGSEERS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggctggtgcagccaggacagctctttcctgaagcttgtgaagaaatacgggaacatt
tttagcctggacttcggtgatgtgccttcagttgttataactggattgcccttaattaag
gaagcccttgtccaccaggacccaaacttcgtgaaccgccctgtaatccctctccgagaa
cgtgtctttaagcaaaatggattgatcatgtccaacggccaggtatggaaggagcaaaga
aggtttgccctgacaacgctgaggaactttggtttgggaaagaagaacttggaggaacgc
attcaggaggaggcccaccacctcatccaggcaatagaggaggagaatggacagcctttt
aaccctcacttcaagatcaacaatgcagtttccaatattatttgctccatcacctttgga
gagcgctttgagtacgaggatggtcagtttcgagaactcctgaggatgctggatgaggtc
acccatctggaggcatcactgtggtgccaactctacaatgcctttccacggataatgaac
ttccttcctggcccccaccaaacactctttagcaactgggacaaactgaaattgtttgtt
gctcgtgtaattgaaaaccacaaaagagactggaaccctgccgaaacaagagactttatt
gatgcttacctcaaggaaatggaaaagtataagggcgatgtcacttcaagtttccatgaa
gaaaacctcatctacagtaccctggacctcttctttgctggaaccgagacgacttcgaca
acactgcgctggggtctgctctacttggccctctacccagaagtccaagaaaaagtacac
gctgaaatcaacagcgtgataggcccggggcagcagccgagcacagcggctcgcacgtcc
atgccctacaccaatgccgtcatccacgaggtgcagaggatggggaacatcatccccctg
aacgtgcccagggaggtggtggtcgacaccagcctggccgggtaccacctgcccaagggg
accatgatcctgaccaatctcactgcgctgcaccgggaccctgcagagtgggccactccc
aacaccttcaatccagagcacttcctggagaatggacagtttaagaaaagggaaaccttt
ctgcctttctcagcaggaaagcgcatgtgccttggagagcagttggccaagtctgagttg
ttcattttctttacgtcccttctgcaaagatttaccttcaggcccccaagcgatgagcag
ctgagcctgaggttcagaatgggcctcaccatcgcccccgccggccaccgcatctgtgct
gttcctcggcaggaaggtgttgcagccagaggagaaagtgagcaagaggagtcctctgag
ggctctggccccttctcagaagtgagggagcaggatgaaggtggctccgaggaaagatca
tag

DBGET integrated database retrieval system