KEGG   Equus caballus (horse): 100067330Help
Entry
100067330         CDS       T01058                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
ecb  Equus caballus (horse)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100067330 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100067330 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100067330 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100067330 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    100067330 (TPM1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100067330 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 239 aa AA seqDB search
MEKLMRASEDERDRVLEELHKAEDSLLAADEAAAKAEADVASLNRRIQLVEEELDRAQER
LATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEV
ARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEI
KVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctaatgcgggcgtcggaggacgagcgggaccgggtgctggaggagctgcac
aaggcggaggacagcctcctggccgccgacgaggccgccgccaaggctgaagccgatgtg
gcctctctgaacagacgcatccagctggttgaggaagagctggatcgtgcccaggagcgt
ctggccacagccctgcagaagctggaggaagccgagaaggcagcagatgagagcgagaga
ggcatgaaagttattgagagccgagcccaaaaggatgaagagaaaatggaaattcaggag
atccaactgaaagaggccaagcacattgctgaagatgccgaccgcaagtatgaagaggtg
gcccgtaagctggtcatcattgagagtgacttggaacgtgcagaggaacgggctgagctc
tcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtgacgaacaacttgaag
tcactggaggctcaggctgagaagtactcacagaaggaagacaaatatgaggaagagatc
aaggtcctttctgacaagctgaaggaggctgagactcgggctgaatttgcagagaggtca
gtaactaaattggagaaaagcattgatgacttagaagacgagctgtacgctcagaaactg
aagtacaaagccatcagcgaggagctggaccacgctctcaacgatatgacttccatataa

DBGET integrated database retrieval system